Recombinant Bovine Leucine-rich repeat-containing protein 3B (LRRC3B)

Shipped with Ice Packs
In Stock

Description

Introduction

Leucine-rich repeat-containing protein 3B (LRRC3B) is a protein encoded by the LRRC3B gene, and it has been identified as a tumor suppressor gene potentially involved in carcinogenesis . LRRC3B contains leucine-rich repeats, which are known to participate in protein-protein interactions . Studies suggest that variations in the LRRC3B gene may contribute to the development and progression of certain cancers, such as breast cancer .

Gene Structure and Polymorphisms

The LRRC3B gene exhibits several single nucleotide polymorphisms (SNPs), which are variations in a single nucleotide within the gene sequence. These SNPs can influence the risk of developing certain diseases. For instance, research has explored the association between LRRC3B SNPs and breast cancer (BC) .

Specific LRRC3B polymorphisms, such as rs6551122 and rs12635768, have been linked to smaller breast cancer tumor sizes. Other variants, including rs112276562, rs6551122, and rs73150416, have been associated with a lower incidence of progesterone receptor (PR)-positive breast cancer . The rs6788033 polymorphism is correlated with lower expression levels of Ki-67, a marker of cell proliferation, in breast cancer .

Table 1: Association between LRRC3B Polymorphisms and Clinical Features of Breast Cancer

PolymorphismClinical FeatureOdds Ratio (OR)p-value
rs6551122Smaller tumor size (<2cm)0.510.028
rs12635768Smaller tumor size (<2cm)0.360.023
rs112276562Lower incidence of PR+ BC0.560.002
rs73150416Lower incidence of PR+ BC0.570.005
rs6788033Lower Ki-67 expression0.640.030

Role in Breast Cancer

Multiple studies suggest that LRRC3B SNPs contribute to breast cancer risk, suggesting that LRRC3B variants might help predict BC progression . A study showed that the 'GATT' haplotype in Block 2 had a higher risk for BC (OR = 1.29, 95% CI: 1.00–1.65, p = 0.048) .

Table 2: False-Positive Report Probability (FPRP) Values for Associations between LRRC3B Polymorphisms and Breast Cancer Susceptibility

PolymorphismGenetic ModelFPRP Value
rs1907168Heterozygote0.184
rs112276562Heterozygote0.095
rs73150416Heterozygote0.159
rs73150416Dominant0.189

LRRC3B as a Predictor of Immunotherapy Response

DNA hypomethylation of LRRC3B could be used to predict anti-PD-1 treatment outcomes in NSCLC and BRCA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
LRRC3B; Leucine-rich repeat-containing protein 3B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-259
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
LRRC3B
Target Protein Sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Uniprot No.

Target Background

Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.