Recombinant Bovine Leucine-rich repeat-containing protein 3 (LRRC3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LRRC3; Leucine-rich repeat-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-257
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
LRRC3
Target Protein Sequence
CPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRE LDLSQNAIETIGPAAFSGLAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMF GWFAMVITYVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP
Uniprot No.

Target Background

Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Leucine-rich repeat-containing protein 3 (LRRC3)?

Bovine LRRC3 is a protein encoded by the LRRC3 gene in Bos taurus (cattle), belonging to the leucine-rich repeat (LRR) protein family. These proteins are characterized by specific structural motifs known as leucine-rich repeats that typically mediate protein-protein interactions. The bovine LRRC3 protein is referenced in sequence databases with the accession number NP_001092354.1 . Like other LRR proteins, bovine LRRC3 likely participates in diverse cellular processes including immune function, cell adhesion, and signal transduction. LRR proteins often feature a distinct structural organization that enables specific molecular recognition and binding to various partners, making them important in many biological systems.

What are the structural characteristics of bovine LRRC3?

Bovine LRRC3 likely features the characteristic horseshoe fold structure common to LRR proteins, as observed in structural analyses of related proteins . This distinctive arrangement consists of multiple LRR motifs forming a curved, solenoid structure. Each LRR typically contains a β-strand-turn-α-helix motif, with the β-strands forming the concave face of the horseshoe and the α-helices forming the convex face. The concave surface often serves as a binding interface for protein-protein interactions.

Experimental studies of LRR proteins using circular dichroism (CD) spectroscopy have shown that these proteins often contain significant β-sheet content, sometimes differing from theoretical predictions. For example, one LRR protein (rLIC11505) showed 46.2% β-sheet and 6.9% α-helix content experimentally, while theoretical predictions suggested 11.0% β-sheet and 38.6% α-helix . This indicates that purification conditions and experimental factors can significantly affect the observed secondary structure of LRR proteins, a consideration relevant for bovine LRRC3 structural studies.

How conserved is LRRC3 across species?

LRRC3 appears well-conserved across multiple vertebrate species, suggesting important biological functions. Based on available sequence data, LRRC3 homologs have been identified in various species from mammals to fish:

SpeciesProtein IDCommon Name
Bos taurusNP_001092354.1Cattle
Homo sapiensNP_112153.1Human
Pan troglodytesXP_531581.2Chimpanzee
Macaca mulattaNP_001181169.1Rhesus monkey
Canis lupus familiarisXP_005639018.1Dog
Rattus norvegicusNP_663712.1Norway rat
Mus musculusNP_660134.1House mouse
Xenopus tropicalisXP_004917845.1Tropical clawed frog
Danio rerioNP_001107114.1Zebrafish

This conservation across diverse vertebrate lineages suggests functional importance . Detailed sequence comparison studies would be necessary to assess the degree of conservation in specific domains and potential species-specific adaptations that might indicate specialized functions.

What expression systems are optimal for recombinant bovine LRRC3?

Based on successful approaches with similar LRR proteins, bacterial expression systems, particularly E. coli, can be effective for recombinant bovine LRRC3 production. The pAE expression vector has been successfully used for expressing LRR proteins in bacteria, with proteins being obtained in the soluble fraction after bacterial lysis . This vector system typically includes a six-histidine tag at the N-terminal region, facilitating subsequent purification.

For optimal bovine LRRC3 expression, researchers should consider:

  • Gene sequence optimization: Design constructs that exclude signal peptide sequences if present, as observed in successful LRR protein expression studies .

  • Expression conditions: Test various induction parameters (temperature, IPTG concentration, duration) to optimize protein yield and solubility.

  • Specialized E. coli strains: Use strains designed for improved expression of eukaryotic proteins if standard strains yield poor results.

  • Alternative expression systems: Consider yeast, insect cells, or mammalian cells if E. coli expression yields improperly folded protein or if post-translational modifications are required for functional studies.

When designing expression constructs, careful attention to the amplification of the correct gene region is essential, with appropriate restriction sites added to oligonucleotide primers for proper insertion into the chosen expression vector .

What purification strategies yield the highest purity and activity of recombinant bovine LRRC3?

For high-purity recombinant bovine LRRC3, a multi-step purification approach is recommended based on successful purification of related LRR proteins:

  • Initial purification via metal affinity chromatography:

    • Use Ni-NTA or similar metal affinity matrix for His-tagged proteins

    • Optimize imidazole concentrations in binding, washing, and elution buffers

    • Consider adding low concentrations of reducing agents to prevent disulfide bond formation

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Ion exchange chromatography for removing contaminants with different charge properties

  • Quality control assessments:

    • SDS-PAGE with Coomassie staining to assess purity

    • Western blotting with anti-His antibodies to confirm identity

    • Measure protein concentration using validated methods

In published studies with LRR proteins, this approach yielded 0.38-0.43 mg/mL of purified recombinant protein . Throughout the purification process, monitoring protein stability is crucial, as some LRR proteins may be prone to aggregation or degradation. Optimization of buffer conditions (pH, salt concentration, additives) may be necessary to maintain protein stability during purification and storage.

How can researchers verify the structural integrity of purified recombinant bovine LRRC3?

Verification of structural integrity is crucial for ensuring that recombinant bovine LRRC3 maintains its native conformation. Multiple complementary approaches should be employed:

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure composition (α-helix, β-sheet percentages)

    • Compare experimental results with theoretical predictions from software like BeStSel

    • Important consideration: Studies with LRR proteins have shown significant differences between theoretical and experimental secondary structure composition

  • Size Exclusion Chromatography (SEC):

    • Assess homogeneity and detect potential aggregation

    • Compare elution profile with theoretical molecular weight

    • Combine with multi-angle light scattering for absolute molecular weight determination

  • Structural Modeling and Validation:

    • Use AlphaFold or similar tools to generate theoretical models

    • Validate the presence of characteristic horseshoe folds expected in LRR proteins

    • Compare predicted and experimental structural parameters

  • Functional Assays:

    • Verify binding to predicted ligands as a proxy for correct folding

    • Assess dose-dependent binding with calculated dissociation constants

    • Confirm specificity through competitive binding assays

The importance of experimental verification is highlighted by studies showing that purification conditions can significantly affect protein structure, with observed differences between predicted and experimental secondary structure compositions for LRR proteins .

What binding partners has bovine LRRC3 been shown to interact with?

While specific binding partners for bovine LRRC3 are not directly documented in current literature, insights can be drawn from studies of related LRR proteins. Based on the functional analysis of LRR proteins from other organisms, potential binding partners for bovine LRRC3 might include:

  • Extracellular Matrix (ECM) Components:

    • Collagen I, which has been shown to interact with some LRR proteins in dose-dependent manner

    • Cellular fibronectin, another potential binding partner observed with related LRR proteins

    • Other structural ECM proteins that may recognize the LRR motifs

  • Glycosaminoglycans (GAGs):

    • Various LRR proteins have been shown to interact with GAGs

    • These interactions often contribute to pathogen adhesion or host cell recognition

  • Cell Surface Receptors:

    • Integrin receptors have been identified as binding partners for some LRR proteins

    • These interactions may mediate cell adhesion or signaling processes

It's important to note that the binding specificity of LRR proteins can vary significantly. Some LRR proteins (like rLIC11051) show restricted binding profiles, while others (like rLIC11505) exhibit broader binding capacity to multiple ligands . Therefore, experimental verification is essential to determine the specific interaction partners of bovine LRRC3.

What experimental approaches are best for studying LRRC3 interactions with host components?

Based on successful methodologies used with similar proteins, researchers studying bovine LRRC3 interactions should consider:

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Immobilize potential binding partners (ECM proteins, GAGs) on microplate wells

    • Incubate with increasing concentrations of recombinant bovine LRRC3

    • Detect bound protein using specific antibodies or anti-tag antibodies

    • Generate saturation binding curves for quantitative analysis

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics measurement

    • Determination of association and dissociation rate constants

    • Label-free detection of molecular interactions

    • Ability to detect even transient interactions

  • Pull-down Assays and Co-immunoprecipitation:

    • Use tagged recombinant bovine LRRC3 as bait

    • Capture potential interacting partners from tissue or cell lysates

    • Identify binding partners through mass spectrometry

  • Cell Binding Assays:

    • Assess binding of labeled recombinant LRRC3 to various cell types

    • Use flow cytometry to quantify binding

    • Perform competition assays to determine specificity

These approaches should be used complementarily, as each provides different information about the binding characteristics and can help validate interactions observed with other methods .

How can researchers determine the binding kinetics of bovine LRRC3 with potential ligands?

For detailed binding kinetic analysis of bovine LRRC3 interactions, researchers should employ multiple complementary techniques:

  • ELISA-based Saturation Binding Assays:

    • Immobilize fixed amounts of potential ligands

    • Incubate with increasing concentrations of recombinant LRRC3

    • Generate saturation curves to determine equilibrium dissociation constants (Kd)

    • For dose-dependent binding, data can be fitted to the equation:
      A = Amax × [protein] / (Kd + [protein])
      Where A is the absorbance at a given protein concentration, Amax is the maximum absorbance at saturation, and [protein] is the protein concentration

  • Surface Plasmon Resonance (SPR):

    • Immobilize either LRRC3 or its ligand on a sensor chip

    • Flow the binding partner at various concentrations

    • Determine association rate constant (kon) and dissociation rate constant (koff)

    • Calculate affinity constant (KD = koff/kon)

    • Assess binding models (1:1, bivalent analyte, etc.)

  • Isothermal Titration Calorimetry (ITC):

    • Measure heat changes during binding events

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

    • Calculate stoichiometry and binding constants

    • Advantage: Does not require protein labeling or immobilization

  • Microscale Thermophoresis (MST):

    • Measures changes in fluorescent molecule movement in microscopic temperature gradients

    • Requires minimal sample amounts

    • Works well with challenging targets

    • Provides Kd values in solution

Multiple approaches provide more robust characterization of binding kinetics and can reveal different aspects of the interaction. Studies with related LRR proteins have successfully employed ELISA-based methods to determine dissociation constants for specific ligands .

What are the key considerations when designing qPCR experiments to study bovine LRRC3 expression?

When designing qPCR experiments to study bovine LRRC3 expression, researchers should adhere to MIQE guidelines (Minimum Information for Publication of Quantitative Real-Time PCR Experiments) and follow these key considerations:

  • Primer and Probe Design:

    • Know your gene's structure, including exon organization and transcript variants

    • Design primers that span exon-exon junctions to avoid genomic DNA amplification

    • Check for SNPs in the primer binding regions that could affect annealing

    • Ensure specificity using BLAST or similar tools to avoid cross-reactivity

    • Consider using predesigned qPCR assays that incorporate these design parameters

  • RNA Sample Handling:

    • Implement careful sample processing procedures to prevent RNA degradation

    • Assess RNA integrity using methods like Bioanalyzer or gel electrophoresis

    • Treat samples with DNase to eliminate genomic DNA contamination

    • RNA quality is critical as it can severely impact expression analysis accuracy

  • Reverse Transcription Strategy:

    • Choose a high-quality reverse transcriptase with minimal bias

    • Use consistent amounts of RNA input across samples

    • Consider that reverse transcriptase enzyme biases or RNA template differences can impact results

  • Experimental Replication:

    • Include both technical replicates to ensure accuracy

    • Use biological replicates to account for biological variability

    • Technical replicates confirm experimental accuracy while biological replicates help determine true changes in expression levels

  • Assay Optimization and Validation:

    • Perform primer efficiency tests using standard curves

    • Optimize annealing temperatures and reaction conditions

    • Validate amplicon identity by melt curve analysis or sequencing

Following these guidelines will help ensure reliable and reproducible results when analyzing bovine LRRC3 expression patterns .

How should researchers normalize bovine LRRC3 expression data?

Proper normalization is critical for accurate interpretation of qPCR data for bovine LRRC3. Researchers should follow these evidence-based approaches:

  • Select Appropriate Reference Genes:

    • Choose multiple reference genes (at least 3) that show stable expression across experimental conditions

    • Common bovine reference genes include GAPDH, ACTB, and PPIA, but their stability should be verified for specific tissues/conditions

    • Use algorithms like geNorm, NormFinder, or BestKeeper to assess reference gene stability

    • Using a single reference gene can lead to biased results and should be avoided

  • Validate Reference Gene Stability:

    • Test candidate reference genes across all experimental conditions

    • Calculate expression stability values

    • Select the most stable combination of reference genes

    • This is especially important when analyzing different tissue types or comparing healthy vs. diseased states

  • Apply Appropriate Normalization Methods:

    • Calculate relative expression using the 2^(-ΔΔCt) method when PCR efficiencies are close to 100%

    • Use efficiency-corrected calculations when PCR efficiencies vary significantly

    • Consider geometric averaging of multiple reference genes

  • Include Normalization Controls:

    • Use inter-run calibrators for experiments requiring multiple qPCR plates

    • Include identical samples across different runs to account for run-to-run variation

    • This is particularly important for large-scale studies involving multiple tissues or time points

The importance of proper normalization cannot be overstated, as it ensures that observed changes in bovine LRRC3 expression reflect true biological variation rather than technical artifacts, addressing one of the key challenges in gene expression analysis .

What tissue-specific expression patterns have been observed for bovine LRRC3?

While comprehensive data on bovine LRRC3 tissue expression patterns is limited in current literature, a methodological approach to determining these patterns would include:

  • Systematic qPCR Analysis:

    • Collect diverse bovine tissue samples (brain, heart, lung, liver, kidney, spleen, intestine, reproductive organs, etc.)

    • Extract high-quality RNA from each tissue type following rigorous protocols to prevent degradation

    • Perform reverse transcription and qPCR with optimized bovine LRRC3-specific primers

    • Normalize expression using validated reference genes

    • Present data as relative expression levels across tissues

  • RNA-Seq Analysis:

    • Utilize existing bovine RNA-Seq datasets from resources like NCBI GEO or ENA

    • Quantify LRRC3 transcript abundance across different tissues and conditions

    • Validate key findings using qPCR

    • This approach allows for genome-wide expression analysis and identification of potential co-regulated genes

  • Protein-Level Confirmation:

    • Develop specific antibodies against bovine LRRC3

    • Perform western blot analysis of protein extracts from various tissues

    • Use immunohistochemistry to visualize tissue and cell-specific localization

    • Correlate protein expression with mRNA levels to identify potential post-transcriptional regulation

Researchers should be mindful that biological variability can significantly impact expression studies, necessitating sufficient biological replicates to identify true trends or validate processes occurring in specific tissue types . Analyzing one sample once provides limited information, while running sufficient replicates delivers statistically significant data that verifies observed changes in expression levels.

How can structural modeling inform functional studies of bovine LRRC3?

Structural modeling can significantly enhance functional studies of bovine LRRC3 by providing insights into its molecular mechanisms. Based on the information from related LRR proteins, researchers can employ the following approaches:

  • Generate High-Quality Structural Models:

    • Use AlphaFold or similar AI-based modeling tools to predict bovine LRRC3 structure

    • Validate models through comparison with experimental data (CD spectroscopy)

    • Identify the characteristic horseshoe fold and LRR motifs typical of this protein family

    • Recognize that experimental validation is crucial, as observed differences between predicted and experimental structures have been documented for LRR proteins

  • Predict Functional Domains and Binding Interfaces:

    • Analyze the concave surface of the horseshoe structure, which typically serves as a protein-protein interaction interface

    • Identify conserved residues that may be involved in ligand binding

    • Compare with known structures of LRR proteins with characterized binding partners

    • Use conservation analysis across species to identify functionally important regions

  • Design Structure-Guided Mutations:

    • Select residues predicted to be critical for binding or function

    • Create point mutations to test functional hypotheses

    • Assess the impact of mutations on ligand binding and downstream signaling

    • This allows for experimental validation of structure-based predictions

  • Molecular Docking Studies:

    • Predict interactions with potential binding partners identified from related LRR proteins

    • Calculate binding energies and identify key interacting residues

    • Prioritize experimental validation of predicted interactions

Structural models should be considered working hypotheses that require experimental validation. The observed discrepancies between theoretical and experimental secondary structure compositions in LRR proteins emphasize this point .

What approaches can resolve contradictory findings about LRRC3 function across different experimental models?

When faced with contradictory findings about bovine LRRC3 function across different experimental models, researchers should implement a systematic troubleshooting and validation approach:

  • Standardize Experimental Conditions:

    • Ensure consistent protein preparation methods across laboratories

    • Verify protein folding and integrity using biophysical techniques like CD spectroscopy

    • Standardize assay conditions and reagents

    • Document detailed methodologies to enable replication

  • Cross-Validate Using Multiple Techniques:

    • Employ orthogonal approaches to test the same hypothesis

    • Use both in vitro binding assays and cell-based functional assays

    • Validate key findings in different model systems

    • This strategy helps identify technique-specific artifacts

  • Address Technical Variables:

    • Assess the impact of tags (His, GST, etc.) on protein function

    • Compare full-length versus truncated constructs

    • Evaluate the influence of expression systems (bacterial vs. mammalian)

    • Consider how purification methods might affect protein folding and activity

  • Implement Rigorous Controls:

    • Include negative controls (non-binding proteins with similar properties)

    • Use positive controls (known interactions with well-characterized parameters)

    • Implement competition assays to verify specificity of observed interactions

    • Controls help distinguish specific effects from background or non-specific interactions

  • Statistical Rigor:

    • Ensure adequate sample sizes for statistical power

    • Use appropriate statistical tests for data analysis

    • Report effect sizes along with p-values

    • Following MIQE guidelines improves experimental reproducibility

Resources like the MIQE guidelines provide a framework for ensuring consistent assay performance and solving technical deficiencies in experiments, helping resolve contradictory findings by standardizing experimental approaches .

How can researchers assess the impact of post-translational modifications on bovine LRRC3 function?

Post-translational modifications (PTMs) can significantly impact protein function. To assess their influence on bovine LRRC3, researchers should:

  • Identify Potential PTM Sites:

    • Use bioinformatic tools to predict potential modification sites (phosphorylation, glycosylation, etc.)

    • Compare with PTMs observed in LRRC3 homologs from other species

    • Focus on evolutionary conserved sites as functionally important candidates

    • Understand that experimental design must account for these potential modifications

  • Detect PTMs Experimentally:

    • Express recombinant bovine LRRC3 in mammalian expression systems that support proper modifications

    • Analyze using mass spectrometry to identify and map PTMs

    • Compare PTM patterns between recombinant and native bovine LRRC3

    • This provides a comprehensive map of actual rather than just predicted modifications

  • Generate PTM-Specific Variants:

    • Create site-directed mutants where potential PTM sites are modified

    • Express phosphomimetic mutants (e.g., S→D or S→E) to mimic phosphorylation

    • Use enzymatic treatments to remove specific modifications (phosphatases, glycosidases)

    • These approaches allow direct testing of PTM functional significance

  • Comparative Functional Analysis:

    • Compare binding properties of modified versus unmodified LRRC3

    • Assess changes in protein-protein interactions using methods like SPR or ELISA

    • Measure alterations in stability, solubility, or subcellular localization

    • Determine if PTMs create new binding interfaces or disrupt existing ones

  • PTM-Specific Antibodies:

    • Develop antibodies that specifically recognize modified forms of bovine LRRC3

    • Use these for detecting PTM status in different tissues or conditions

    • Monitor dynamic changes in PTM patterns in response to stimuli

When designing expression systems for functional studies, researchers should consider that bacterial systems like E. coli typically lack the machinery for eukaryotic PTMs, which may affect protein function if these modifications are critical . Mammalian expression systems might be necessary if PTMs are essential for proper LRRC3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.