Recombinant Bovine Leukocyte antigen CD37 (CD37)

Shipped with Ice Packs
In Stock

Description

CD37 Biology and Functions

CD37 is characterized by four transmembrane domains and participates in forming tetraspanin-enriched microdomains (TEMs), interacting with integrins and other transmembrane proteins . Key functions include:

  • Immune cell regulation: Modulating T-cell activation and proliferation .

  • Apoptosis induction: In B-cell malignancies, CD37-targeted therapies trigger apoptosis via caspase-independent pathways .

  • Disease association: CD37 deficiency in mice correlates with B-cell lymphoma development .

Recombinant CD37 in Research and Therapy

While bovine CD37 is not documented, human and murine CD37 have been extensively studied:

Human CD37 Therapies

TargetTherapeutic ApproachMechanismEfficacy
B-cell malignanciesCD37-SMIP (small modular immunopharmaceuticals)Induces apoptosis via cross-linking; mediates ADCC (antibody-dependent cellular cytotoxicity) through NK cells .Superior cytotoxicity to rituximab and alemtuzumab in CLL models .
Lymphoma/LeukemiaCAR-T cells (CD37-targeted)Redirects T-cells to kill CD37+ tumor cells.Effective in xenograft models; correlates with CD37 antigen density .

Murine CD37

  • Antibody development: High-affinity murine anti-CD37 antibodies (e.g., clone 2B8) with KD = 1.6 nM have been engineered for lymphoma targeting .

  • CAR-T specificity: Humanized CD37-CAR-T cells show cytotoxicity against CD37+ Raji and CHO-CD37 cells but not CD37- controls .

Gaps in Bovine CD37 Research

The provided sources lack data on bovine CD37, highlighting critical knowledge gaps:

  1. Structural and Functional Analogy: No studies compare bovine CD37 to human/murine homologs.

  2. Therapeutic Potential: No evidence exists for bovine CD37’s role in disease or as a therapeutic target.

  3. Production Methods: Recombinant bovine CD37’s expression systems (e.g., E. coli, mammalian cells) and purification strategies remain undefined.

Implications for Future Research

To advance bovine CD37 research, the following steps are recommended:

  1. Genomic Sequencing: Compare bovine CD37’s nucleotide/protein sequence to human/murine homologs.

  2. Expression Profiling: Validate CD37 expression in bovine immune cells using IHC, FACS, or RT-qPCR.

  3. Therapeutic Exploration: Test CD37-targeted agents (e.g., antibodies, CAR-T cells) in bovine disease models.

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. For lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based solution with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we understand that you may have specific requirements. If you require a particular delivery format, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), working aliquots should be stored at 4°C.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard protocol includes 50% glycerol; you may adjust this as needed.
Shelf Life
The shelf life of this product is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized powder, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses to prevent repeated freeze-thaw cycles, which can negatively impact protein integrity.
Tag Info
N-terminal 10xHis-tagged
Synonyms
CD37; Leukocyte antigen CD37; CD antigen CD37
Datasheet & Coa
Please contact us to get it.
Expression Region
1-280aa
Mol. Weight
37.8 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKVLAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVKDVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCSCYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNNLISIVGICLGVGLLELSFMTLSIFLCRNLDHVYDRLARYR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CD37 and what cell types express this antigen?

CD37 is a tetraspanin molecule primarily expressed on B cells and some T cells. It is considered a lineage-specific B-cell antigen that has historically received less attention as a therapeutic target compared to other B-cell markers . Recent research has demonstrated that CD37 is expressed not only in B-cell malignancies but also in acute myeloid leukemia (AML) and T-cell lymphomas . The protein is predominantly expressed on the surface of mature B cells, making it an attractive target for B-cell malignancies including chronic lymphocytic leukemia (CLL) and B-cell non-Hodgkin lymphoma (B-NHL) . Single-cell RNA sequencing of AML patient samples has confirmed that CD37 expression is predominantly restricted to malignant cell populations, with consistent expression observed across multiple patients .

CD37 expression varies across different hematological malignancies. Flow cytometry and immunohistochemistry (IHC) have been developed as clinical assays to assess CD37 expression in patient tumor samples . In AML, CD37 expression has been found to correlate with the European LeukemiaNet (ELN) 2017 risk stratification, suggesting it may have prognostic significance in this disease . The detection of CD37 on the surface of AML cells might be antibody-dependent, as studies have shown different antibodies exhibit varying sensitivities for CD37 detection .

What are the major isoforms of CD37 and how do they affect antibody recognition?

CD37 exists in multiple isoforms, with at least three main isoforms identified. Research has shown that the distribution of CD37 mRNA isoforms differs between normal and AML bone marrow samples, though all isoforms are expressed to some degree in AML . When these isoforms were overexpressed in HEK cells for testing antibody recognition, researchers discovered that both the HH1 and M-B371 antibodies specifically recognized only isoform 1 of CD37 . This selectivity for specific isoforms has important implications for designing therapeutic antibodies and establishing detection methods.

The recognition of CD37 by different antibodies appears to be strongly isoform-dependent, which may explain variations in detection efficacy across different studies and antibody clones. This highlights the importance of selecting appropriate antibodies for both research and clinical applications targeting CD37. The differential recognition of CD37 isoforms suggests that therapeutic approaches may need to be tailored to target the specific isoforms expressed in a particular disease context .

How does CD37 expression in AML compare to other established therapeutic targets?

In comparative studies of AML patient samples, CD37 positivity in the bulk tumor population has been shown to be similar to that of validated CAR targets CD33 and CD123 . This is significant because CD33 and CD123 are well-established targets for immunotherapy in AML. Additionally, CD37 has been detected in AML leukemic stem cell (LSC) populations, suggesting it may be valuable for targeting therapy-resistant stem-like cells that often drive disease relapse .

Unlike some other potential AML targets that are expressed on healthy hematopoietic stem and progenitor cells (HSPCs), the more restricted expression pattern of CD37 on mature B cells and malignant cells may offer a more favorable safety profile for targeted therapies . This could potentially reduce off-target toxicities that have limited the development of other AML-targeted immunotherapies. The comparable expression levels to established targets, combined with potentially improved safety profiles, position CD37 as a promising alternative target for AML therapy.

What mechanisms of action are exhibited by CD37-targeted therapies?

CD37-targeted therapies demonstrate multiple mechanisms of action that contribute to their anti-tumor activity. Research has shown that CD37-directed antibodies can induce direct apoptosis of target cells when cross-linked . For example, a CD37-specific small modular immunopharmaceutical (CD37-SMIP) was shown to induce potent apoptosis in the presence of a cross-linker, with the level of apoptosis correlating with CD37 expression levels on target cells . This direct induction of apoptosis represents an important mechanism by which CD37-targeted therapies can eliminate malignant cells.

CD37-directed therapies also harness immune effector functions through their Fc regions. Antibody-dependent cellular cytotoxicity (ADCC) is a key mechanism, predominantly mediated by natural killer (NK) cells. Studies have demonstrated that CD37-SMIP can induce ADCC against B-cell leukemia/lymphoma cell lines and primary CLL cells with efficacy superior to therapeutic antibodies currently used to treat these diseases . Additionally, antibody-dependent cellular phagocytosis (ADCP) and complement-dependent cytotoxicity (CDC) contribute to the anti-tumor activity of CD37-targeted therapies . Novel approaches to enhance these effector functions include the development of biparatopic antibodies with hexamerization-enhancing mutations, such as DuoHexaBody-CD37, which has demonstrated potent and superior CDC activity compared to other CD37 antibody variants .

How does CD37 CAR-T cell therapy compare to other CAR-T approaches in hematological malignancies?

CD37-directed chimeric antigen receptor (CAR) T cells represent a novel approach to targeting CD37-expressing malignancies. Research has shown that CD37 CAR-T cells exhibit specific cytotoxicity against CD37-expressing tumor cells, including AML cells, and produce inflammatory cytokines consistent with a T helper 1 (Th1)-like profile, including IFN-γ, TNF-α, and IL-2 . While CD37 CAR-T cells may be less potent than CD33 CAR-T cells in some contexts, they have demonstrated efficacy against both CD37-high and CD37-low expressing cell lines, suggesting high functional avidity of the CAR construct .

An important consideration for CD37 CAR-T therapy is its potential application in patients who have relapsed after CD19-directed CAR-T therapy. Clinical trials are investigating CD37 CAR-T cells in patients with relapsed or refractory CD37-positive hematologic malignancies, including those who have failed CD19 CAR-T therapy . The expression of CD37 in both B-cell and T-cell lymphomas makes it a particularly versatile target that could potentially address unmet needs in T-cell malignancies, where effective CAR-T approaches have been more challenging to develop .

What are the potential advantages of CD37 as a target compared to other B-cell antigens?

CD37 offers several potential advantages as a therapeutic target compared to other B-cell antigens such as CD19, CD20, and CD52. One key advantage is the expression of CD37 across multiple hematological malignancies, including B-cell lymphomas, T-cell lymphomas, and AML . This broad expression pattern makes CD37 a versatile target that could potentially address multiple disease types with a single therapeutic approach.

In the context of AML, CD37 expression correlates with the European LeukemiaNet (ELN) 2017 patient prognostic stratification, suggesting it may have prognostic significance . This correlation could potentially allow for better patient selection for CD37-targeted therapies. Additionally, CD37 appears to be more restricted to malignant cells in AML compared to some other targets, potentially offering improved safety profiles for targeted therapies .

For B-cell malignancies that have relapsed after CD19-directed therapies, CD37 represents an alternative target that remains expressed on these resistant cells. The unique epitopes on CD37 also allow for the development of novel therapeutic modalities, such as biparatopic antibodies that target two non-overlapping epitopes simultaneously, enhancing effector functions like CDC . This approach has been demonstrated with DuoHexaBody-CD37, which combines dual epitope targeting with a hexamerization-enhancing mutation to achieve superior complement activation .

What techniques are used to assess CD37 expression in patient samples?

Multiple complementary techniques are employed to assess CD37 expression in patient samples, each with specific advantages. Flow cytometry using CD37-specific antibodies is a primary method for detecting surface expression of CD37 on individual cells . Clinical assays have been developed to assess CD37 expression on patient tumor samples using both flow cytometry and immunohistochemistry (IHC) . These techniques allow for quantitative assessment of CD37 positivity and expression levels, which can be correlated with clinical features and outcomes.

The choice of antibody is critical for accurate CD37 detection. Research has shown that different antibodies, such as HH1 and M-B371, may have varying sensitivities for detecting CD37 expressed on different cell types . For example, the HH1 antibody has demonstrated superior sensitivity for detecting CD37 on AML cells compared to other antibodies . Validation of antibody specificity can be performed using knockout cell lines, as demonstrated with a U-937 CD37 knockout model that confirmed the specificity of the HH1 antibody .

At the transcript level, single-cell RNA sequencing has been used to evaluate CD37 mRNA expression in patient samples . This approach provides insights into the cell-type-specific expression patterns of CD37 and can identify the predominant cellular populations expressing CD37 in heterogeneous samples. Single-cell transcriptomic analysis has confirmed that CD37 mRNA is predominantly expressed in malignant cell populations in AML patients . These complementary approaches to assessing CD37 expression provide researchers with robust tools for characterizing CD37 as a therapeutic target in various hematological malignancies.

How are functional assays designed to evaluate CD37-targeted therapies?

Functional assays for evaluating CD37-targeted therapies are designed to assess multiple mechanisms of action, including direct cytotoxicity, immune effector functions, and in vivo efficacy. Cytotoxicity assays typically involve co-culturing CD37-targeted therapeutics with CD37-expressing target cells and measuring cell death through various methods. For CD37 CAR-T cells, cytotoxicity against target cell lines and primary patient samples can be evaluated, along with analysis of T-cell activation markers such as CD107a degranulation .

Immune effector function assays assess the ability of CD37-targeted antibodies to engage immune mechanisms. Complement-dependent cytotoxicity (CDC) assays are performed by incubating target cells with CD37-targeted antibodies in the presence of normal human serum as a complement source . Antibody-dependent cellular cytotoxicity (ADCC) assays typically use peripheral blood mononuclear cells (PBMCs) or isolated NK cells as effectors, with CD37-positive target cells pretreated with the therapeutic antibody . These assays have demonstrated that NK cells, but not naive or activated monocytes, mediate CD37-SMIP-dependent ADCC in vitro .

In vivo efficacy is evaluated using xenograft models, such as SCID mouse models engrafted with human leukemia or lymphoma cells . These models allow for assessment of therapeutic efficacy in a more complex biological system. The contribution of specific immune cell populations to in vivo efficacy can be evaluated through depletion studies, as demonstrated with NK cell depletion in a mouse model, which resulted in diminished efficacy of CD37-SMIP therapy . This finding highlighted the important role of NK cells in the therapeutic mechanism of CD37-targeted therapies.

What are the key considerations in designing CD37-directed CAR T cells?

Designing effective CD37-directed CAR T cells involves multiple critical considerations to optimize both safety and efficacy. Antibody selection is fundamental, as the single-chain variable fragment (scFv) derived from the antibody will determine CAR specificity and sensitivity. Research has shown that antibodies like HH1 may offer superior sensitivity for detecting CD37 on certain tumor types like AML . The choice of antibody should also consider which CD37 isoforms are recognized, as studies have shown that antibodies like HH1 and M-B371 specifically recognize isoform 1 of CD37 .

CAR construct design must balance efficacy with safety considerations. The intracellular signaling domains influence CAR T cell activation, proliferation, and persistence. Clinical CAR designs have incorporated co-stimulatory domains such as 4-1BB along with CD3ζ for optimal T cell activation . Additional features like truncated EGFR reporter genes can be included to facilitate detection and potential depletion of CAR T cells if necessary .

Manufacturing processes and lymphodepletion regimens also impact CAR T cell efficacy. Clinical manufacturing using systems like the CliniMACS Prodigy® has been employed for CD37 CAR T cell production . Lymphodepletion regimens, such as fludarabine and cyclophosphamide, are used to prepare patients for CAR T cell infusion . Dose finding is a critical aspect of early clinical trials, with dose escalation designs to identify the optimal therapeutic dose while monitoring for dose-limiting toxicities .

Monitoring CAR T cell persistence, expansion, and functional activity in patients provides valuable insights into therapeutic mechanisms and potential correlates of response. Clinical trials incorporate correlative studies focused on quantification and persistence of CAR-positive cells in blood, assessment of residual tumor, and measurement of cytokine modulation . These studies help elucidate the in vivo behavior of CD37 CAR T cells and inform future optimization strategies.

What are the potential limitations and toxicities of CD37-targeted therapies?

Despite promising preclinical results, CD37-targeted therapies face several potential limitations and toxicities that researchers must address. One observed challenge with CD37 CAR-T cells is decreased viability following transduction. Studies have reported a 30-40% reduction in viability of CD37 CAR-T cells 12 days after transduction, which affects the expansion of the T cells . This could potentially impact manufacturing yield and therapeutic efficacy, requiring optimization of CAR design or manufacturing protocols.

Cytokine release syndrome (CRS) and neurotoxicity are well-documented toxicities of CAR-T cell therapies that could also occur with CD37 CAR-T cells. Clinical trials are carefully monitoring for these adverse events through dose escalation designs and implementation of safety measures . The potential for antigen escape or downregulation following CD37-targeted therapy is another limitation that may necessitate combinatorial approaches or targeting of multiple antigens to prevent disease relapse .

How might combinatorial approaches enhance CD37-targeted therapies?

Combinatorial approaches represent a promising strategy to enhance the efficacy of CD37-targeted therapies and overcome potential limitations. Targeting multiple antigens simultaneously could prevent disease relapse associated with antigen loss, a phenomenon observed in B-cell malignancies treated with single-antigen targeted therapies . Dual-targeting approaches could combine CD37 with other B-cell antigens like CD19 or CD20 for B-cell malignancies, or with myeloid antigens like CD33 or CD123 for AML.

Enhancing effector functions through innovative antibody engineering represents another combinatorial approach. The development of biparatopic antibodies that target two non-overlapping epitopes on CD37, such as DuoHexaBody-CD37, has demonstrated superior complement-dependent cytotoxicity compared to traditional antibody formats . Further engineering to enhance Fc-mediated effector functions or incorporate hexamerization-enhancing mutations could further improve therapeutic efficacy .

Combination with immune checkpoint inhibitors could potentially enhance the efficacy of CD37 CAR-T cells by preventing T cell exhaustion and promoting sustained anti-tumor activity. Similarly, combination with agents that modify the tumor microenvironment could overcome immunosuppressive mechanisms that limit CAR-T cell efficacy. These combinatorial approaches require careful preclinical evaluation to identify optimal combinations and dosing regimens before clinical translation.

What novel CD37-targeted therapeutic modalities are under development?

Several innovative CD37-targeted therapeutic modalities are currently under development, expanding beyond traditional antibodies and CAR-T cells. Biparatopic antibodies like DuoHexaBody-CD37, which target two non-overlapping epitopes on CD37, have demonstrated superior complement-dependent cytotoxicity through enhanced IgG hexamerization mediated by the E430G mutation . This approach exemplifies how dual epitope targeting combined with novel engineering strategies can create therapeutics with improved effector functions.

Small modular immunopharmaceuticals (SMIPs) represent another innovative approach to targeting CD37. These molecules include variable regions linked to modified human IgG1 hinge, CH2, and CH3 domains, and have demonstrated potent apoptosis induction and antibody-dependent cellular cytotoxicity against B-cell malignancies . The smaller size of these molecules compared to traditional antibodies may offer advantages in tissue penetration while maintaining effector functions and avoiding rapid elimination through engineering approaches that maintain a molecular weight above the glomerular filtration threshold .

Antibody-drug conjugates (ADCs) targeting CD37 could leverage the specific binding of anti-CD37 antibodies to deliver cytotoxic payloads directly to CD37-expressing malignant cells. While not explicitly mentioned in the search results, this approach has been successful with other B-cell antigens and represents a logical extension for CD37-targeted therapy development. The continued innovation in CD37-targeted therapeutic modalities promises to expand the armamentarium available for treating CD37-expressing hematological malignancies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.