Recombinant Bovine Leukocyte cell-derived chemotaxin 1 (LECT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNMD; CHMI; LECT1; Leukocyte cell-derived chemotaxin 1; Chondromodulin; Small cartilage-derived glycoprotein; SCGP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
215-335
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CNMD
Target Protein Sequence
ELVRKIVTTTTTRRLRSGPQGTPAPGRPNNGTRPSVQEDAEPFNPDNPYHQQEGESMTFD PRLDHEGICCIECRRSYTHCQKICEPLGGYHPWPYNYQGCRSACRVIMPCSWWVARILGM V
Uniprot No.

Target Background

Function
Recombinant Bovine Leukocyte cell-derived chemotaxin 1 (LECT1) is a bifunctional growth regulator. It stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF), but inhibits the growth of cultured vascular endothelial cells. LECT1 may contribute to the rapid cartilage growth and vascular invasion preceding cartilage replacement by bone during endochondral bone development. It also inhibits in vitro tube formation and endothelial cell mobilization. Furthermore, it functions as an antiangiogenic factor in cardiac valves, suppressing neovascularization.
Database Links

KEGG: bta:281683

UniGene: Bt.1509

Protein Families
Chondromodulin-1 family
Subcellular Location
[Chondromodulin-1]: Secreted, extracellular space, extracellular matrix. Note=Accumulated in the inter-territorial matrix of cartilage.; [Chondrosurfactant protein]: Endomembrane system; Single-pass membrane protein.
Tissue Specificity
Nasal and articular cartilage, and fetal epiphysis.

Q&A

What is Leukocyte cell-derived chemotaxin 1 (LECT1) and what are its primary biological functions?

LECT1, also known as Chondromodulin-1 (ChM-I), is a glycosylated transmembrane protein that undergoes cleavage to form a mature secreted protein. The mature protein serves multiple critical functions, including promoting chondrocyte growth and inhibiting angiogenesis. LECT1 plays a significant role in endochondral bone development by facilitating the process through which cartilaginous anlagen become vascularized and are subsequently replaced by bone. The protein exhibits specific expression patterns, being predominantly found in the avascular regions of prehypertrophic cartilage, with expression levels decreasing during vascular invasion and chondrocyte hypertrophy .

What is the molecular structure of recombinant LECT1 and how does it compare between species?

Human recombinant LECT1 produced in E. coli consists of a single polypeptide chain containing 144 amino acids (residues 214-334) with a molecular mass of approximately 16.3 kDa. In typical recombinant preparations, it is fused to a 23 amino acid His-tag at the N-terminus to facilitate purification . While the search results do not provide specific information about bovine LECT1's structure, researchers should anticipate similar core structural elements with species-specific variations in amino acid sequence.

When expressing recombinant bovine LECT1, researchers typically need to optimize the expression construct based on codon usage preferences and the required post-translational modifications. For functional studies, preserving the native folding pattern is crucial, particularly for the cysteine-rich domains that likely form disulfide bonds critical to the protein's functionality.

What expression systems are most effective for producing functional recombinant bovine LECT1?

The choice of expression system depends on the intended application and required protein characteristics. Based on approaches used for similar proteins, the following options should be considered:

  • Bacterial Systems (E. coli): Suitable for producing non-glycosylated domains or when post-translational modifications are not critical. These systems offer high yields and cost-effectiveness but may require refolding protocols to ensure proper disulfide bond formation .

  • Yeast Systems (P. pastoris, S. cerevisiae): Provide basic eukaryotic post-translational modifications with higher yields than mammalian systems.

  • Mammalian Expression Systems: Optimal for producing fully glycosylated and properly folded protein but typically yield lower quantities.

For immunological studies similar to those conducted with BbAMA-1, bacterial expression systems have proven effective when producing specific domains (such as ectodomains I and II) of the target protein .

What purification strategies yield the highest purity and functional activity for recombinant bovine LECT1?

Based on established protocols for similar recombinant proteins, an effective purification strategy would include:

  • Affinity Chromatography: Using His-tag affinity purification as the initial capture step, with optimization of binding and elution conditions to maximize yield .

  • Secondary Purification: Implementing ion exchange or size exclusion chromatography to achieve >90% purity, as verified by SDS-PAGE analysis .

  • Buffer Optimization: Formulating in appropriate buffer conditions that maintain stability and functionality. For human LECT1, a solution containing 20mM Tris-HCl buffer (pH 8.0), 0.4M urea, and 10% glycerol has proven effective .

  • Storage Considerations: Storing at 4°C for short-term use (2-4 weeks) or at -20°C with a carrier protein (0.1% HSA or BSA) for long-term stability, while avoiding repeated freeze-thaw cycles .

Purification StepMethodParametersExpected Outcome
Initial CaptureHis-tag Affinity ChromatographyNi-NTA resin, imidazole gradient elution60-80% purity
Intermediate PurificationIon Exchange ChromatographypH-dependent binding/elution80-90% purity
PolishingSize Exclusion ChromatographyBuffer exchange, removal of aggregates>90% purity
Quality ControlSDS-PAGE and Western BlottingElectrophoretic separation, antibody detectionVerification of size and identity

How can researchers effectively design immunization studies using recombinant bovine LECT1?

Drawing from the methodological approach used in the BbAMA-1 study, researchers should consider the following for LECT1 immunization studies:

  • Dosage Optimization: Testing multiple concentrations (e.g., 50μg and 100μg) to determine optimal immune response induction .

  • Adjuvant Selection: Utilizing appropriate adjuvants like Montanide ISA 206 VG, which has been effective in bovine immunization studies .

  • Immunization Schedule: Implementing a prime-boost strategy with carefully timed administrations to maximize immune response development.

  • Comprehensive Immune Response Assessment: Monitoring both humoral (antibody) and cellular (T-cell) responses through multiple techniques .

The immunization protocol should be designed to evaluate dose-dependent responses while minimizing animal numbers through careful statistical power calculations.

What methods are most effective for measuring immune responses to recombinant bovine LECT1?

Based on immune response assessment techniques used for similar recombinant proteins, researchers should implement:

  • Antibody Response Analysis:

    • Western blotting to confirm antigen-specific recognition

    • Indirect ELISA to quantify total IgG antibodies and isotype distribution (IgG1/IgG2 ratio)

    • Flow cytometry to assess binding to native protein

  • Cellular Immune Response Evaluation:

    • Flow cytometric analysis of antigen-specific CD4+ and CD8+ T cells producing IFN-γ and TNF-α

    • Lymphocyte proliferation assays following antigen stimulation

    • Cytokine profiling through ELISA or multiplex assays

  • Gene Expression Analysis:

    • RT-qPCR to quantify expression of relevant cytokines (IFN-γ, TNF-α, IL-2, IL-12) and other immune mediators (iNOS)

    • RNA-seq for global transcriptomic analysis

Immune ParameterMeasurement TechniqueExpected Outcome for Effective Immunogen
Antibody ResponseIndirect ELISAIncreasing titers post-immunization, sustained for 8-10 weeks
IgG Isotype RatioIsotype-specific ELISAIgG2/IgG1 ratio >1 (indicating Th1 bias)
T-cell ResponseFlow CytometryIncreased CD4+ and CD8+ T cells producing IFN-γ and TNF-α
Cytokine ProfileRT-qPCRUpregulation of Th1 cytokines (IFN-γ, TNF-α, IL-2, IL-12)
Inflammatory MediatorsRT-qPCRUpregulation of iNOS, downregulation of IL-4, IL-6, IL-10

How can researchers assess the functional activity of recombinant bovine LECT1 in vitro?

Functional assessment of recombinant bovine LECT1 should evaluate its known biological activities:

  • Chondrocyte Growth Promotion:

    • Primary bovine chondrocyte cultures supplemented with recombinant LECT1

    • Measurement of proliferation using BrdU incorporation or MTT assays

    • Analysis of chondrocyte-specific gene expression (collagen II, aggrecan)

  • Angiogenesis Inhibition:

    • Endothelial cell tube formation assays

    • Chick chorioallantoic membrane (CAM) assays

    • Endothelial cell migration and proliferation assays

  • Binding Interaction Studies:

    • Surface plasmon resonance (SPR) to determine binding kinetics with potential partners

    • Co-immunoprecipitation to identify protein-protein interactions

    • Yeast two-hybrid screening for novel interaction partners

  • Signaling Pathway Analysis:

    • Western blotting for phosphorylation events

    • Reporter gene assays for transcriptional regulation

    • Calcium flux measurements for rapid signaling events

What are the critical factors to consider when comparing recombinant bovine LECT1 with the native protein?

When evaluating the similarities and differences between recombinant and native bovine LECT1, researchers should consider:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to compare secondary structure

    • Mass spectrometry to identify post-translational modifications

    • Limited proteolysis to assess domain folding and accessibility

  • Glycosylation Analysis:

    • Comparing glycosylation patterns between native and recombinant proteins

    • Assessing the impact of glycosylation on function through enzymatic deglycosylation

    • Lectin binding assays to characterize glycan structures

  • Functional Comparison:

    • Side-by-side testing in functional assays described in section 4.1

    • Dose-response studies to determine EC50/IC50 values

    • Competition assays between native and recombinant forms

  • Antibody Recognition:

    • Using antibodies against native protein to detect recombinant protein

    • Epitope mapping to ensure critical antigenic determinants are preserved

What strategies can address poor expression yields of recombinant bovine LECT1?

When facing expression challenges, researchers should systematically evaluate:

  • Codon Optimization: Adapting the bovine LECT1 sequence to the codon usage preferences of the expression host.

  • Expression Construct Design: Testing different fusion tags (His, GST, MBP, SUMO) and optimizing tag placement (N-terminal vs. C-terminal).

  • Host Strain Selection: Screening multiple E. coli strains (BL21(DE3), Rosetta, Origami) or alternative expression systems based on protein requirements.

  • Induction Conditions: Optimizing temperature (16-37°C), inducer concentration, and induction duration to maximize soluble protein yield.

  • Solubility Enhancement: Adding solubility-enhancing agents (glycerol, sorbitol, arginine) to the culture medium or including chaperone co-expression plasmids.

How can researchers address challenges in studying the immunological effects of recombinant bovine LECT1?

Based on approaches used in similar immunological studies , researchers facing challenges should consider:

  • Antigen Quality: Ensuring high purity (>90% by SDS-PAGE) and proper folding of the recombinant protein .

  • Adjuvant Optimization: Testing multiple adjuvant formulations if initial immune responses are suboptimal.

  • Cellular Assay Sensitivity: Optimizing in vitro re-stimulation conditions by varying antigen concentration, incubation time, and cell culture conditions.

  • Flow Cytometry Protocol Refinement: Improving staining protocols with titrated antibodies and appropriate controls to enhance detection of low-frequency antigen-specific T cells.

  • PCR Assay Optimization: Designing highly specific primers and optimizing PCR conditions for accurate quantification of cytokine gene expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.