CD47, also known as integrin-associated protein (IAP), belongs to the immunoglobulin superfamily and is extensively expressed across various cell types. The bovine variant of CD47 shares significant structural and functional homology with human and other mammalian CD47 proteins but maintains species-specific characteristics that make it valuable for comparative immunological studies . The mature bovine CD47 protein consists of amino acids 19-303 of the full protein sequence, representing the biologically active portion of the molecule after signal peptide cleavage .
The amino acid sequence of bovine CD47 (Q9N0K1) is as follows: QLIFNAIKSVEYTLCNQTVVIPCFVNNVETKNITELYVRWKFKGENIFIFDGSQRMSKPS SNFSSAEIAPSELLRGIASLKMAKSDAVLGNYTCEVTELSREGETIIELKYRVVSWFSPN ENILIVIFPVLAILLFWGQFGIVTLKYKSNYTKEKAIFLLVAGLLLTVLVIVGAFLFIPG GYSTKNASGLGLIVLPTIILILLHYCVFMIAMGMSSFTISILILQLLGYVLSVVGFSLCV SECIPVHGPLLISGLGIIALAELLGLVYMKCVASNHRTIQPPRNN . This sequence contains the characteristic immunoglobulin-like domain and multiple transmembrane regions that are essential for its biological functions.
The bovine CD47 gene is located on the bovine genome and encodes the leukocyte surface antigen CD47. Alternative gene names include IAP (Integrin-Associated Protein) . The gene produces a protein that serves as a cell surface marker and receptor involved in multiple cellular recognition processes. Understanding the genetic basis of bovine CD47 has significant implications for bovine immunology and comparative studies with human immune systems.
Recombinant Bovine Leukocyte surface antigen CD47 can be produced using various expression systems, each offering distinct advantages depending on the intended application. The choice of expression system significantly impacts protein yield, post-translational modifications, and ultimately, biological activity.
Multiple expression systems are employed for the production of recombinant bovine CD47, including bacterial (E. coli), yeast, baculovirus-infected insect cells, and mammalian cell systems . Each system has unique characteristics that influence the final protein product:
| Expression System | Advantages | Limitations | Typical Purity | Post-translational Modifications |
|---|---|---|---|---|
| E. coli | High yield, cost-effective, simple culture conditions | Limited post-translational modifications, potential inclusion body formation | >90% after purification | Minimal glycosylation |
| Yeast | Moderate yield, some post-translational modifications | More complex than bacterial systems | 85-95% | Moderate glycosylation, different pattern than mammalian |
| Baculovirus/Insect Cells | Better post-translational modifications than bacteria/yeast | More expensive, longer production time | 85-95% | Good glycosylation but not identical to mammalian |
| Mammalian Cells | Most authentic post-translational modifications | Most expensive, lowest yield, complex culture conditions | 85-95% | Extensive and authentic glycosylation |
The commercially available full-length recombinant bovine CD47 is often produced in E. coli with an N-terminal His tag, resulting in a protein with purity greater than 90% as determined by SDS-PAGE . This approach provides a good balance between yield and functionality for many research applications.
Affinity chromatography using the His-tag represents the primary purification method for recombinant bovine CD47 expressed in E. coli . The purification process typically involves:
Cell lysis to release the recombinant protein
Immobilized metal affinity chromatography (IMAC) using the His-tag
Additional purification steps such as ion exchange chromatography or gel filtration
Quality control assessment by SDS-PAGE, with purity typically greater than 85-90%
The final product is often provided as a lyophilized powder to ensure stability during shipping and storage . Reconstitution in an appropriate buffer (typically Tris/PBS-based buffer with 6% trehalose, pH 8.0) prepares the protein for experimental use .
Bovine CD47, like its counterparts in other species, plays crucial roles in cellular communication and immune regulation. Understanding these functions has important implications for bovine immunology and potential veterinary applications.
The primary interaction partner of CD47 is SIRPα, with this interaction forming the basis of the "don't eat me" signal that prevents phagocytosis of healthy cells . Recombinant bovine CD47 maintains the ability to interact with bovine SIRPα, making it useful for studying this critical immune checkpoint in bovine systems.
Additionally, bovine CD47 interacts with various integrins, similar to human CD47. These interactions are important for:
Cell adhesion and migration
Neutrophil function
Platelet activation
The functional binding capabilities of recombinant bovine CD47 can be assessed through various binding assays, similar to those used for human CD47, where immobilized SIRPα is used to measure the binding affinity of CD47 .
Bovine CD47 functions as a regulator of phagocytosis through its interaction with SIRPα on macrophages . This interaction triggers signaling cascades that ultimately inhibit phagocytic activity. The mechanism involves:
CD47 binding to SIRPα
Phosphorylation and activation of SIRPα
Recruitment and activation of SHP phosphatases
Dephosphorylation of myosin 2a
This mechanism is fundamental to preventing inappropriate phagocytosis of healthy cells and maintaining immune homeostasis in bovine systems.
Recombinant bovine CD47 serves as an important tool in various research contexts, from basic immunological studies to more applied research in veterinary medicine and comparative immunology.
In fundamental immunological research, recombinant bovine CD47 enables studies on:
Bovine macrophage function and regulation
Phagocytosis mechanisms in bovine immune cells
Comparative analysis of CD47-SIRPα interactions across species
Structure-function relationships in CD47 biology
These applications contribute to our understanding of bovine immune system function and provide valuable comparative data for human immunology research.
The study of bovine CD47 has important implications for veterinary medicine:
Understanding bovine infectious diseases and immune responses
Developing potential immunotherapeutic approaches for bovine diseases
Investigating immune evasion mechanisms of bovine pathogens
Creating diagnostic tools based on CD47-related immune pathways
Comparing bovine CD47 with its counterparts in other species provides valuable insights into the evolution and conservation of this important immune regulator.
Bovine CD47 shares significant sequence homology with human, mouse, and rat CD47, reflecting the evolutionary conservation of this protein across mammalian species. The extracellular IgV domain, in particular, demonstrates high conservation, underscoring its functional importance in CD47-SIRPα interactions.
Despite sequence variations, the core functions of CD47 appear conserved across species, including:
Regulation of phagocytosis through SIRPα interaction
Association with various integrins
This functional conservation makes bovine CD47 a valuable model for studying fundamental aspects of CD47 biology with potential translational relevance.
The study of recombinant bovine CD47 continues to evolve, with several promising areas for future investigation:
Detailed structural characterization of bovine CD47 and its interaction with bovine SIRPα
Development of bovine-specific CD47-targeting therapies for veterinary applications
Exploration of CD47's role in bovine-specific diseases and immune responses
Comparative studies examining species-specific differences in CD47 function and regulation
These research directions will further enhance our understanding of bovine CD47 and potentially lead to novel applications in both basic science and veterinary medicine.
CD47 plays a dual role in cell adhesion, acting as an adhesion receptor for thrombospondin-1 (THBS1) on platelets and modulating integrin activity. It is crucial for memory formation and synaptic plasticity in the hippocampus. CD47 also serves as a receptor for SIRPA, inhibiting immature dendritic cell maturation and cytokine production in mature dendritic cells. Its interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell proliferation, and costimulates T-cell activation. CD47 may participate in membrane transport, integrin-dependent signal transduction, red blood cell longevity, and membrane permeability changes during viral infection.
STRING: 9913.ENSBTAP00000048646
UniGene: Bt.87076
CD47 is a transmembrane protein widely expressed on the surface of various cells that functions primarily as a "don't eat me" signal by interacting with SIRPα on phagocytic cells. This interaction delivers inhibitory signals to macrophages, preventing the phagocytosis of CD47-expressing cells, which is essential for normal immune homeostasis. CD47 contains an extracellular immunoglobulin variable (IgV) domain, a transmembrane region, and a cytoplasmic tail, with the IgV domain being critical for SIRPα binding . Beyond its role in phagocytosis inhibition, CD47 also interacts with thrombospondin-1 and integrins to mediate cell proliferation, migration, apoptosis, and other cellular responses . In the context of immune regulation, CD47 expression is carefully balanced to ensure that healthy cells are protected from inappropriate phagocytosis while allowing for the clearance of damaged or senescent cells. The CD47-SIRPα axis represents a key immune checkpoint that regulates innate immune surveillance, making it a significant target for therapeutic interventions in various disease contexts.
While the search results don't specifically detail bovine CD47 structure, we can infer important comparative aspects from the documented interspecies differences. Like the 73% amino acid sequence compatibility between pig and human CD47, bovine CD47 likely has species-specific variations that affect cross-species recognition . These structural differences are particularly important because they impact the ability of CD47 to interact with SIRPα from different species. The IgV domain of CD47 contains species-specific post-translational modifications, especially glycosylation patterns, that significantly influence receptor binding capabilities . In the context of xenotransplantation research, these species differences are crucial, as demonstrated by the finding that porcine CD47 fails to induce SIRPα tyrosine phosphorylation in human macrophage-like cells . This interspecies incompatibility in CD47-SIRPα signaling represents a significant barrier to xenotransplantation, suggesting that bovine CD47 would likely face similar compatibility issues with human SIRPα. Understanding these structural and functional differences is essential for developing effective strategies for xenotransplantation and cross-species immune studies.
Recombinant CD47 production typically employs several different strategies, each with specific advantages for research applications. The most common approach involves creating chimeric proteins to enhance expression and secretion, as seen with recCD47, which incorporates domains 3 and 4 of rat CD4 protein to improve secretion from Chinese Hamster Ovary (CHO) cell lines . This modification significantly enhances protein yield but introduces non-native sequences that may complicate certain applications, particularly those intended for clinical use. Alternatively, researchers have developed peptide-based approaches using the 22 amino acid sequence from the Ig domain of CD47's extracellular region (pepCD47), which has been shown to confer similar bioactive properties to the full recombinant protein . For studies requiring cell surface expression, researchers often use expression vectors containing full-length CD47 cDNA, such as the pKS336-human CD47 system described for expressing human CD47 on porcine cells . More recently, advanced genetic engineering techniques have allowed for the creation of modified versions like CD47-IgV, where the transmembrane and intracellular domains are replaced with glycosylphosphatidylinositol (GPI) anchor to preserve SIRPα interaction while eliminating potentially detrimental intracellular signaling . Each production approach offers distinct advantages depending on the specific research requirements and downstream applications.
Producing functional recombinant bovine CD47 presents several significant challenges that researchers must overcome. First, species-specific post-translational modifications, particularly glycosylation patterns, critically affect CD47's ability to interact with SIRPα receptors, making the choice of expression system critical for maintaining proper protein folding and modification . Second, the hydrophobic nature of CD47's transmembrane domain often leads to poor protein solubility and aggregation during expression and purification, necessitating specialized solubilization protocols or the creation of chimeric constructs to enhance protein stability and yield . Third, preserving the native conformation of the IgV domain, which is essential for SIRPα binding, can be difficult during recombinant production, often requiring careful optimization of expression conditions and purification strategies. Fourth, validating the functionality of recombinant bovine CD47 presents challenges due to the species-specific nature of CD47-SIRPα interactions, requiring appropriate assays that can accurately measure bovine CD47 binding to relevant SIRPα variants . Finally, scaling up production while maintaining consistent protein quality represents an ongoing challenge for applications requiring larger amounts of recombinant protein, such as structural studies or therapeutic development.
CD47 can be strategically modified in several ways to enhance or alter its functional properties for various research and therapeutic applications. One significant approach involves creating a mutant CD47 (CD47-IgV) by replacing the transmembrane and intracellular domains with a GPI membrane anchor, which preserves the critical SIRPα interaction while eliminating potentially detrimental intracellular signaling pathways . This modification allows CD47 to efficiently inhibit phagocytosis both in vitro and in vivo comparable to wild-type CD47, but without transmitting cell death signals or inhibiting angiogenesis . Another effective strategy involves focusing on just the functional 22 amino acid peptide sequence (pepCD47) from the IgV domain, which offers practical and economic advantages over full-length recombinant proteins while still maintaining bioactive properties . For xenotransplantation applications, replacing species-specific CD47 with human CD47 on animal cells has proven highly effective, radically reducing their susceptibility to phagocytosis by human macrophages . Researchers have also explored protein engineering approaches to enhance CD47 stability, half-life, or binding affinity through site-directed mutagenesis of specific amino acid residues in the IgV domain. These modification strategies provide valuable tools for investigating CD47 biology and developing novel therapeutic approaches targeting the CD47-SIRPα axis.
Recombinant CD47 plays a pivotal role in xenotransplantation research by addressing one of the fundamental barriers to successful cross-species transplantation: innate immune rejection by macrophages. Studies have demonstrated that the interspecies incompatibility of CD47 significantly contributes to xenograft rejection, as evidenced by the finding that porcine CD47 fails to initiate inhibitory SIRPα signaling in human macrophages . Researchers have shown that genetic manipulation of porcine cells to express human CD47 radically reduces their susceptibility to phagocytosis by human macrophages, providing a novel approach to preventing macrophage-mediated xenograft rejection . This strategy is considered more effective than using soluble CD47-Fc fusion proteins, likely because cell surface expression provides more efficient CD47-SIRPα signaling through direct cell-cell contact . Recent advancements include the development of mutant CD47 constructs like CD47-IgV that preserve the protective function against phagocytosis without the potential detrimental effects of wild-type CD47 signaling, offering a potentially effective means for transgenic CD47 expression that may help produce gene-edited pigs for xenotransplantation . These approaches represent significant progress in overcoming innate immune barriers to xenotransplantation, complementing other strategies that address complement activation and coagulation incompatibilities.
Several experimental models have been developed to assess CD47-SIRPα interactions across species, particularly in the context of xenotransplantation research. In vitro phagocytosis assays using fluorescently labeled target cells (such as CFSE-stained cells) co-cultured with macrophages represent a primary method for evaluating CD47's ability to inhibit phagocytosis . Flow cytometry analysis of double-positive macrophages (e.g., CD14+ and CFSE+) provides a quantitative measure of phagocytic activity, allowing researchers to compare the effects of different CD47 variants or modifications . Biochemical assays measuring SIRPα tyrosine phosphorylation in macrophages following interaction with CD47-expressing cells provide direct evidence of functional signaling, as demonstrated in studies comparing porcine CD47's inability to induce phosphorylation in human macrophage-like THP-1 cells . For in vivo assessment, mouse models using immunodeficient or syngeneic backgrounds have been employed to evaluate the leukemogenic potential of cells expressing different CD47 variants, comparing their survival and engraftment capabilities . Specialized animal models, such as sublethally irradiated mice transplanted with CD47-expressing cells, allow researchers to assess long-term engraftment and the immunoprotective effects of CD47 in vivo . These complementary experimental approaches provide a comprehensive assessment of CD47-SIRPα interactions across species barriers.
Recombinant CD47 provides versatile tools for evaluating phagocytic activity across various experimental settings, enabling researchers to dissect the complex regulatory mechanisms of innate immunity. In soluble form, recombinant CD47-Fc fusion proteins can be used as competitive inhibitors to block CD47-SIRPα interactions, allowing researchers to quantify the contribution of this pathway to phagocytic regulation in different cell types or species combinations . Surface expression models, where target cells are transfected to express recombinant CD47 variants, provide systems to evaluate how modifications to CD47 structure affect phagocytic susceptibility, as demonstrated with human CD47-expressing porcine cells that showed significantly reduced uptake by human macrophages . In macrophage activation studies, recombinant CD47 can be used to investigate the signaling pathways downstream of SIRPα, particularly by measuring tyrosine phosphorylation events that regulate phagocytic activity . For tissue-based applications, CD47-modified biomaterials can be employed to assess how local CD47 presentation affects immune cell recruitment and activation in different tissue microenvironments . In disease models, particularly cancer, recombinant CD47 variants can be used to study how CD47 overexpression contributes to immune evasion and disease progression, informing the development of CD47-targeted therapeutics . These diverse experimental applications of recombinant CD47 have significantly advanced our understanding of phagocytic regulation in health and disease.
Post-translational modifications (PTMs) of CD47, particularly glycosylation patterns, critically influence its cross-species functionality and recognition by SIRPα receptors. Research has indicated that species-specific PTMs significantly impact the ability of CD47 to deliver inhibitory signals to macrophages, as evidenced by studies showing that CD47 on pig but not mouse, cow, or rat red blood cells can bind to recombinant extracellular domains of human SIRPα1 . These glycosylation differences appear to be a key factor in determining whether cross-species CD47-SIRPα interactions can effectively deliver signals inhibiting engulfment, explaining why porcine CD47 fails to induce SIRPα tyrosine phosphorylation in human macrophage-like cells despite some level of binding . The importance of these modifications extends beyond mere binding capacity to influence the strength and duration of inhibitory signaling pathways that control macrophage phagocytic activity. From a research perspective, understanding these species-specific PTM patterns is essential when producing recombinant bovine CD47, as the expression system chosen must be capable of generating the appropriate glycosylation profile to maintain functional properties. This remains particularly challenging when expressing mammalian proteins in non-mammalian systems, which may lack the enzymatic machinery for producing the correct PTM patterns, potentially affecting both the structure and function of recombinant CD47 proteins.
The molecular mechanisms underlying CD47's ability to inhibit phagocytosis involve a complex signaling cascade initiated by its interaction with SIRPα on phagocytic cells. When CD47 binds to SIRPα, it triggers tyrosine phosphorylation of immunoreceptor tyrosine-based inhibition motifs (ITIMs) in the SIRPα cytoplasmic domain, leading to the recruitment and activation of Src homology 2 domain-containing phosphatases (SHP-1 and SHP-2) . These phosphatases subsequently dephosphorylate multiple substrates involved in phagocytic pathways, effectively counterbalancing activating signals generated by prophagocytic receptors such as Fcγ and complement receptors . Modified CD47 variants like CD47-IgV retain this inhibitory function by preserving the critical IgV domain that interacts with SIRPα while eliminating potential detrimental effects associated with intracellular signaling through CD47's cytoplasmic domain . This selective preservation of function explains why CD47-IgV can efficiently protect against phagocytosis both in vitro and in vivo to a level comparable with wild-type CD47, without transmitting cell death signals or inhibiting angiogenesis . Interestingly, the phagocytic regulation extends beyond simple on/off signaling to a balanced integration of signal strength between inhibitory receptors like SIRPα and activating receptors, creating a threshold that determines whether phagocytosis proceeds . This complex signal integration explains why species-specific differences in CD47-SIRPα interactions can have such profound effects on xenogeneic recognition and rejection by macrophages.
The CD47-SIRPα axis extends its influence well beyond direct phagocytosis inhibition to modulate multiple aspects of innate and adaptive immunity. Research has revealed that CD47-SIRPα signaling affects dendritic cell migration, maturation, and cytokine production, thereby indirectly regulating the priming and activation of T cell responses . This connection to adaptive immunity is particularly relevant in cancer immunotherapy, where blocking CD47 not only enhances tumor cell phagocytosis but also activates the cyclic GMP-AMP (cGAMP) synthase/cGAMP/interferon gene stimulating factor signaling pathway, initiating adaptive immune responses that contribute to tumor cell killing . CD47's interaction with thrombospondin-1 represents another significant pathway that regulates nitric oxide signaling, cell adhesion, and migration, impacting vascular responses and tissue homeostasis . In the context of hematopoietic stem cells, CD47 signaling influences engraftment and differentiation, as evidenced by studies showing that CD47-IgV expressing cells maintain normal engraftment and blood cell differentiation capabilities while avoiding the detrimental effects of wild-type CD47 . The broad tissue distribution of CD47 and its multiple ligand interactions create a complex regulatory network that fine-tunes immune responses in different physiological and pathological contexts, making it both a fascinating subject for basic immunology research and a promising target for therapeutic intervention in diverse disease states.
Multiple CD47-targeting therapeutic approaches have advanced to clinical development, primarily focusing on cancer immunotherapy applications. Monoclonal antibodies (mAbs) represent the most advanced class of CD47-targeting agents, with several candidates in various phases of clinical trials including Magrolimab (Hu5F9-G4), Lemzoparlimab (TIJC4), Ligufalimab (AK117), and AO-176 . These antibodies function by blocking the CD47-SIRPα interaction, thereby enabling macrophage-mediated phagocytosis of tumor cells . SIRPα-Fc fusion proteins, such as TTI-621 and TTI-622, offer an alternative approach by acting as decoy receptors that bind to CD47 on tumor cells, preventing their interaction with SIRPα on macrophages . More targeted strategies include bispecific antibodies that simultaneously engage CD47 and tumor-specific antigens, enhancing selectivity while reducing on-target off-tumor effects, particularly important for minimizing the hematological toxicities associated with CD47 blockade . Novel delivery approaches utilizing nanotechnology-based systems are being explored to improve the pharmacokinetics and tumor targeting of CD47 inhibitors . Cell-based therapies, including chimeric antigen receptor (CAR) T-cells and CAR macrophages engineered to overcome CD47-mediated inhibition, represent cutting-edge approaches in development . The clinical progress of these various therapeutic modalities is summarized comprehensively in the table from the research, which outlines the different agents, their formats, combination strategies, indications, and current status in clinical trials .
Developing CD47-targeted therapeutics presents several significant challenges that researchers and clinicians must address. The widespread expression of CD47 on normal cells, particularly erythrocytes and platelets, creates substantial on-target off-tumor toxicity concerns, leading to hematological adverse effects including anemia and thrombocytopenia that can limit dosing and efficacy . The complex role of CD47 in normal physiological processes, including cell migration, proliferation, and apoptosis, means that systemic CD47 blockade may disrupt these functions, potentially leading to unexpected side effects beyond hematological toxicities . Limited single-agent efficacy has been observed in clinical trials, necessitating combination approaches with other immunotherapeutic agents or conventional treatments, which increases treatment complexity and potential for adverse interactions . Heterogeneous expression of CD47 across different tumor types and even within the same tumor creates challenges for consistent therapeutic response, requiring strategies to address CD47-low tumor cells that may escape treatment . Patient selection represents another significant challenge, as biomarkers predicting response to CD47-targeted therapy remain poorly defined, complicating the identification of patients most likely to benefit from these approaches . Addressing these challenges has driven innovation in the field, leading to the development of more selective approaches like bispecific antibodies and tumor-targeted delivery systems that aim to improve the therapeutic window of CD47-targeted agents.
Recombinant bovine CD47 could significantly contribute to xenotransplantation advancements by addressing the critical barrier of innate immune rejection. Building on findings that expressing human CD47 on porcine cells dramatically reduces their susceptibility to phagocytosis by human macrophages, similar approaches could be developed using bovine tissues engineered to express human CD47 . This strategy would help overcome the interspecies incompatibility in CD47-SIRPα signaling that significantly contributes to xenograft rejection by macrophages . Advanced genetic engineering approaches could leverage the insights gained from CD47-IgV research to create transgenic bovine tissues expressing modified versions of CD47 that retain protection against phagocytosis without transmitting potentially detrimental intracellular signals . This approach might be particularly valuable in creating gene-edited bovine donors for xenotransplantation, similar to efforts in the porcine model . Recombinant bovine CD47 research could also inform the development of transitional therapies, such as soluble CD47 proteins or peptides that could be administered alongside xenotransplantation to provide temporary protection during the critical early post-transplant period while the graft establishes . Beyond direct applications in transplantation, comparative studies of bovine CD47 structure and function could enhance our fundamental understanding of species-specific immune regulation, potentially revealing new targets or approaches for modulating innate immunity in transplantation contexts . These diverse applications highlight the significant potential contributions of recombinant bovine CD47 research to advancing xenotransplantation as a solution to organ shortage.