Recombinant Bovine Lipase maturation factor 1 (LMF1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Localization

Lipase Maturation Factor 1 (LMF1) is an endoplasmic reticulum (ER) membrane protein that plays a crucial role in the posttranslational folding and assembly of various lipases into their active enzymatic forms . First identified through studies of the combined lipase deficiency (cld) mutation in mice, LMF1 has since been recognized as an essential component for proper lipase function across mammalian species . The protein is primarily localized in the ER, where it contains multiple transmembrane domains with loops extending into the ER lumen that facilitate interaction with nascent lipase polypeptides .

Functional Significance in Lipase Activation

LMF1 serves as a critical maturation factor for multiple vascular lipases, including lipoprotein lipase (LPL), hepatic lipase (HL), and endothelial lipase (EL) . Without functional LMF1, these lipases cannot attain their proper three-dimensional conformation, resulting in misfolded proteins that aggregate and remain trapped within the ER . This retention prevents the lipases from reaching their sites of action, leading to severe metabolic consequences. Studies have demonstrated that cells with loss-of-function mutations in the LMF1 gene are unable to generate active lipases, but regain this capacity after reconstitution with wild-type LMF1 .

Evolutionary Conservation and Structure

LMF1 demonstrates considerable conservation across species, indicating its fundamental importance in lipid metabolism pathways. The protein has a distinctive structure with multiple membrane-spanning domains and specific regions that interact with lipase substrates during their maturation process. Notably, certain amino acid residues, particularly tryptophan residues, appear to be highly conserved and critical for proper LMF1 function, as substitutions at these positions can significantly affect protein structure and function .

Genomic Organization in Cattle

The bovine LMF1 gene has been mapped and characterized in cattle populations, with studies revealing its genomic structure and sequence variations. Similar to its human ortholog, the bovine LMF1 gene contains multiple exons spanning a considerable genomic region . Genetic analysis has identified several polymorphisms within this gene in various cattle breeds, providing insights into its potential role in bovine growth and development .

Identified Polymorphisms and Their Implications

Research has identified a novel missense mutation in exon 4 of the bovine LMF1 gene (NC_007326.3: g.27154 T>C) that results in a significant amino acid substitution (p.197 Trp>Arg) in the LMF1 protein . This specific mutation has been studied in four Chinese cattle breeds: Nanyang (NY), Qinchuan (QC), Jiaxian (JX), and Chinese Holstein (CH), with the T allele being dominant across all populations . Genotype frequencies for this locus were calculated and found to be in Hardy-Weinberg equilibrium (p > 0.05), suggesting stable inheritance of these variants .

The genetic diversity measures for this polymorphism varied considerably among breeds:

Breeds (E4 AvaІ locus)NePICHe (Obs)HO
NY1.540.290.390.61
QC1.130.110.120.88
JX1.370.230.260.74
CH1.000.000.001.00

Table 1: Genetic diversity indices of LMF1 gene E4 AvaІ locus in four Chinese cattle populations. (He: gene heterozygosity; Ho: gene homozygosity; Ne: effective allele numbers; PIC: polymorphism information; Obs: observed)

LMF1's Role in Lipase Maturation

Recombinant bovine LMF1, like its counterparts in other species, functions primarily in the posttranslational maturation of lipases. Research has demonstrated that this protein interacts directly with nascent lipase polypeptides in the ER lumen, facilitating their proper folding and assembly into enzymatically active forms . Without this critical interaction, lipases remain misfolded, form aggregates through inappropriate intermolecular disulfide bonds, and are retained within the ER . These misfolded aggregates are enzymatically inactive, highlighting the essential nature of LMF1 in lipase biogenesis and function .

Interaction Network in the Endoplasmic Reticulum

Advanced proteomic studies using crosslinking techniques have identified an extensive network of proteins that interact with LMF1, suggesting functions beyond simple lipase maturation . These interaction partners fall into several functional categories:

Protein CategoryExamplesFunction
Disulfide bond processingPDIA3, PDI, ERp72, ERp44, ERO1aRedox regulation and disulfide formation
Protein glycosylationCalnexin, UGGT1, Alpha-glucosidase 2Quality control and glycan processing
ChaperonesBiP, Endoplasmin, Cyclophilin BProtein folding assistance
Metal bindingSERCA2, E-Syt1, ZIP7Calcium and zinc homeostasis
Other ER proteinsSEC63, Rab-1A, SEL1LER organization and function

Table 2: LMF1 protein interaction network categorized by functional groupings

Among these interacting proteins, calnexin has been previously shown to enhance LPL maturation and was downregulated in the absence of LMF1, confirming the functional significance of this interaction . The identification of multiple protein disulfide isomerases (PDIs) and other redox-related proteins suggests that LMF1 plays a significant role in maintaining proper redox conditions for lipase folding .

LMF1's Role in Redox Homeostasis

Evidence suggests that LMF1 affects redox homeostasis in the ER, which is crucial for the proper formation of disulfide bonds in lipases . Studies have demonstrated that LPL, but not pancreatic lipase (PL), forms intermolecular disulfide-bonded aggregates when produced in cells, and these aggregates need to be reduced for correct intramolecular disulfides to form . The interaction of LMF1 with multiple redox-regulatory proteins supports its role in creating the appropriate redox environment for lipase maturation, extending its function beyond simple chaperoning activities .

Production Strategies for Recombinant Bovine LMF1

While the search results don't specifically detail methods for recombinant bovine LMF1 production, the research approaches described provide insights into potential strategies. Experimental studies have utilized expression systems with His-tagged LMF1 for purification and identification of interacting proteins . These approaches could be adapted for large-scale production of recombinant bovine LMF1 for research and potential therapeutic applications. Expression systems would need to account for LMF1's membrane-associated nature and complex structure to ensure proper folding and function of the recombinant protein.

Biomedical Applications and Disease Models

Recombinant bovine LMF1 could serve as a valuable tool for studying lipid metabolism disorders in both veterinary and human medicine. Mutations in human LMF1 (Y439X and W464X) have been identified in individuals with severe hypertriglyceridemia and combined lipase deficiency, mirroring similar phenotypes observed in animal models . Recombinant bovine LMF1 could be used to develop screening assays for lipase activity, investigate therapeutic approaches for lipid metabolism disorders, and provide insights into the molecular mechanisms underlying these conditions.

Expanding Functional Understanding

While LMF1's role in lipase maturation is well-established, its broader functions in the ER, particularly in redox homeostasis, warrant further investigation . Future studies should explore the complete interactome of bovine LMF1 and determine how various mutations affect its interaction with both lipases and other ER proteins. Additionally, the mechanisms by which LMF1 variants influence growth traits in cattle require more detailed characterization to establish causality rather than mere association .

Optimization of Recombinant Production

The membrane-associated nature of LMF1 presents challenges for recombinant production and purification while maintaining proper structure and function. Developing optimized expression systems, perhaps utilizing mammalian cells to ensure appropriate post-translational modifications, will be essential for producing functional recombinant bovine LMF1 for research and potential applications .

Translational Applications

Research on bovine LMF1 has broader implications beyond cattle breeding. Understanding how LMF1 functions in lipid metabolism could provide insights relevant to human metabolic disorders. The conservation of LMF1 function across species suggests that findings from bovine studies may translate to human applications, particularly in addressing conditions like hypertriglyceridemia and other lipid metabolism disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LMF1; TMEM112; Lipase maturation factor 1; Transmembrane protein 112
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-561
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
LMF1
Target Protein Sequence
MAAPRESLRRRKAGAGDPEPEAPPGQGRDLKGRPARLRAGTFWLTRIVLLRALAFVYFVA FLVAFHQNKQLIGDRGLLPCRAYLQSVQRHFGGRVSWDALSYAPTILWLLDWSHMDANLD ALALLGLGISSFILVSGCANMVLMAALWVLYMSLVNVGQIWYSFGWESQLLETGFLGIFL CPLWTLSALPRGTPTSWVVMWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPV PNPVAYFLHRSPWWFHRFETLSNHFLELVVPFFIFLGRRMCIVHGALQVLFQVVLIISGN LSFLNWLTIVPSLACFDDATLGGLFPSGPGRLKDQVLKIQEEETRGARAPRTRGSVARGT VNLALGILVAWLSIPVVLNLLSPRQVMNSSFNPLRIVNTYGAFGSITRERTEVILQGTAS ANASAPDSAWEDYEFKCKPGDPRRRPCLISPYHHRLDWLMWFAAFQTYEHNEWIIHLAGK LLANDAQALSLLARNPFEGRDPPRWVRGEHYRYKFSRPGGRHAAEGKWWIRRRLGPYFPP LSRQDLRGYFTSRQWPYPEPE
Uniprot No.

Target Background

Function
LMF1 is involved in the endoplasmic reticulum maturation of specific proteins. It is essential for the maturation and secretory pathway transport of active lipoprotein lipase (LPL). A single LMF1 molecule chaperones 50 or more LPL molecules.
Database Links
Protein Families
Lipase maturation factor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of LMF1 and how does it relate to function?

LMF1 is a polytopic membrane protein located in the endoplasmic reticulum (ER) with a complex domain architecture comprising five transmembrane domains. Its N-terminus resides in the cytosol while its C-terminus extends into the ER lumen . The loops connecting these transmembrane domains (labeled A-D) have differential functions, with loop C and the C-terminal domain being particularly crucial for lipase interaction. The C-terminal region contains a highly conserved domain (DUF1222) that is essential for lipase maturation .

Mapping studies have revealed that while loop C is important for direct physical interaction with dimeric lipases, truncation studies demonstrate that the entire LMF1 protein is required for successful lipase maturation . The complex membrane topology of LMF1 suggests it may facilitate interactions between components on both sides of the ER membrane during the lipase maturation process.

What expression systems are most effective for producing functional recombinant bovine LMF1?

The choice of expression system is critical for obtaining functional recombinant LMF1. Based on published research with human LMF1, several approaches have proven successful:

  • Mammalian expression systems: CHO cells have been effectively used for co-expression of LMF1 with lipases such as LPL . This system provides appropriate post-translational modifications and ER environment for proper folding.

  • Insect cell expression: While less common for LMF1 itself, insect cells (particularly S2 cells) have been used for expressing proteins that interact with LMF1 .

  • Bacterial expression: E. coli has been used to produce recombinant portions of human LMF1 (residues Met1~Leu207) , but this approach is generally better suited for soluble domains rather than full-length membrane proteins.

For most functional studies, mammalian expression systems are preferable as they provide the necessary cellular machinery for proper folding and membrane insertion of LMF1. Co-expression with LPL or other client lipases is often employed to verify functional activity of the recombinant LMF1 .

What are reliable methods to assess the functionality of recombinant bovine LMF1?

Functionality of recombinant bovine LMF1 can be assessed through multiple complementary approaches:

  • Rescue of LMF1-deficient cells: Transfection of recombinant LMF1 into cld/cld cells (cells with the combined lipase deficiency mutation) should restore LPL secretion and activity .

  • Co-immunoprecipitation assays: These can demonstrate physical interaction between LMF1 and its client lipases .

  • Lipase activity assays: The most definitive test is measuring increased lipase activity in the presence of recombinant LMF1. This can be quantified using:

    • ELISA to measure lipase mass and calculate specific activity

    • Direct lipase enzymatic activity assays from cell lysates and media

    • Heparin-release experiments to measure functional lipase secretion

  • Subcellular localization: Confirmation of proper ER localization using fluorescent tags and microscopy .

A comprehensive assessment should include both biochemical interaction studies and functional restoration of lipase activity as complementary measures of recombinant LMF1 functionality.

What molecular mechanisms underlie LMF1-mediated lipase maturation?

The precise molecular mechanism of LMF1-mediated lipase maturation remains incompletely understood, but current evidence suggests a multi-faceted role:

  • Assembly of lipase dimers: LMF1 appears critical for the assembly of partially folded lipase monomers into functional dimers or for stabilizing these homodimers before secretion . This is supported by LMF1's specificity for dimeric lipases (LPL, HL, EL) but not monomeric lipases like pancreatic lipase .

  • Protein quality control: LMF1 interacts with components of ER quality control pathways, including:

    • N-linked glycosylation enzymes (UGGT1, UGGT2)

    • ER-resident oxidoreductases (ERp72, ERp44, ERdj5)

    • Thioredoxin (TRX), which reduces disulfide bonds

  • Redox homeostasis: LMF1 appears to affect redox homeostasis, which is particularly significant for client lipases like LPL that contain multiple disulfide bonds . Its interaction with oxidoreductases suggests a role in facilitating proper disulfide bond formation.

  • Prevention of aggregation: In LMF1-deficient cells, LPL is retained in the ER as inactive aggregates, suggesting LMF1 prevents lipase misfolding and aggregation .

Importantly, the ratio of LMF1 to LPL appears to be low in cells, with each LMF1 molecule facilitating the maturation of approximately 50 LPL molecules , indicating a catalytic rather than stoichiometric mechanism.

How can site-directed mutagenesis be used to identify critical functional residues in bovine LMF1?

Site-directed mutagenesis provides a powerful approach to identify functionally important residues in bovine LMF1:

  • Target selection strategy:

    • Focus on residues in the C-terminal domain and loop C, which are known to interact with lipases

    • Target conserved residues identified through cross-species alignment

    • Examine residues corresponding to known human mutations causing lipase deficiency (e.g., Y439X, W464X)

    • Investigate potential redox-active sites that might interact with thioredoxin or oxidoreductases

  • Functional validation methods:

    • Co-expression of mutant LMF1 with LPL in HEK293T cells

    • Measurement of intracellular and secreted LPL activity using enzymatic assays

    • Analysis of LPL protein levels by western blotting and ELISA

    • Subcellular localization studies using fluorescence microscopy

  • Data interpretation framework:

    • Mutations affecting LMF1-lipase binding versus those affecting catalytic enhancement

    • Mutations disrupting membrane topology versus those altering lumenal domain function

    • Mutations affecting protein stability versus those specifically impairing function

A systematic mutagenesis approach combined with multiple functional readouts can provide comprehensive insights into the structure-function relationships of bovine LMF1, potentially identifying species-specific functional determinants.

What are the most effective approaches for studying LMF1-lipase interactions in vitro?

Several complementary techniques can be employed to characterize LMF1-lipase interactions:

  • Crosslinking coupled with mass spectrometry: This approach has successfully identified LMF1-interacting proteins . The protocol typically involves:

    • Chemical crosslinking of proteins in their native environment

    • Immunoprecipitation of LMF1 complexes

    • Proteomic analysis of crosslinked peptides

    • Computational modeling of interaction interfaces

  • Co-immunoprecipitation assays: These can verify direct interactions between LMF1 and lipases or other binding partners. Key considerations include:

    • Selection of appropriate detergents to solubilize membrane proteins while preserving interactions

    • Use of tagged proteins (such as polyhistidine tags) to facilitate pulldown

    • Controls to confirm specificity of interactions

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): These techniques can provide quantitative binding kinetics for:

    • LMF1 interactions with lipases

    • Effects of mutations on binding affinity

    • Competition with other binding partners

  • Structural biology approaches: While challenging for membrane proteins, techniques such as:

    • Cryo-electron microscopy of membrane preparations

    • X-ray crystallography of soluble domains

    • Hydrogen-deuterium exchange mass spectrometry

  • Functional reconstitution: Purified components can be reconstituted into liposomes or nanodiscs to study:

    • Minimal components required for lipase activation

    • Effects of membrane composition on LMF1 function

    • Sequential assembly of functional complexes

These methods collectively can provide comprehensive insights into the molecular basis of LMF1-lipase interactions and the determinants of specificity and efficiency.

What purification strategies yield highest activity for recombinant bovine LMF1?

Purifying functional LMF1 presents significant challenges due to its membrane-embedded nature. Based on approaches used for human LMF1 and similar membrane proteins, the following strategy is recommended:

  • Expression optimization:

    • Use mammalian expression systems (HEK293 or CHO cells)

    • Include affinity tags (polyhistidine or FLAG) at the C-terminus to avoid interfering with membrane insertion

    • Consider fusion partners that enhance stability and solubility

  • Membrane extraction:

    • Use gentle detergents like digitonin, DDM (n-dodecyl β-D-maltoside), or LMNG (lauryl maltose neopentyl glycol)

    • Optimize detergent concentration to prevent aggregation while maintaining native structure

    • Consider mild solubilization buffers containing glycerol and stabilizing agents

  • Purification protocol:

    • Initial capture using affinity chromatography (IMAC for His-tagged LMF1)

    • Secondary purification via size exclusion chromatography

    • Optional ion exchange chromatography for higher purity

  • Activity preservation:

    • Include lipid additives (such as cholesterol or specific phospholipids) during purification

    • Consider nanodiscs or amphipols for maintaining native-like membrane environment

    • Avoid freeze-thaw cycles; store at 4°C for short-term use

  • Quality control:

    • Assess protein homogeneity via analytical size exclusion chromatography

    • Verify structural integrity using circular dichroism spectroscopy

    • Confirm activity through LPL activation assays

How can researchers optimize the co-expression of bovine LMF1 with client lipases?

Co-expression of LMF1 with its client lipases provides a powerful system to study functional interactions and can improve lipase production. Optimization strategies include:

  • Vector design considerations:

    • Balanced expression levels: Use varying promoter strengths to optimize LMF1:lipase ratio

    • Co-expression formats: Bicistronic vectors with IRES elements versus co-transfection of separate vectors

    • Selectable markers: Dual selection strategies for stable cell line generation

  • Expression system selection:

    • HEK293T cells have been successfully used for co-expression of LMF1 and LPL

    • CHO cells provide robust expression for larger scale production

    • Consider tetracycline-inducible systems for controlled expression timing

  • Optimization parameters:

    • LMF1:lipase ratio: Typically, lower LMF1 expression relative to lipase is sufficient (1:2 ratio has been used successfully)

    • Expression timing: Synchronize expression to optimize chaperone availability

    • Culture conditions: Optimize temperature (32-37°C) and media supplements

  • Functional assessment:

    • Measure both intracellular and secreted lipase activity

    • Compare lipase-alone expression to co-expression with LMF1

    • Analyze specific activity versus total protein to distinguish between effects on lipase amount versus lipase quality

A systematic optimization approach should test multiple conditions, measuring both LMF1 and lipase expression levels alongside functional lipase activity to determine optimal parameters.

What analytical techniques can accurately characterize the membrane topology of recombinant bovine LMF1?

Determining the correct membrane topology of LMF1 is crucial for understanding its function. Multiple complementary techniques can be employed:

  • Fluorescent reporter fusion analysis:

    • Generate fusion proteins with fluorescent proteins (GFP, mCherry) at various positions

    • Use selective permeabilization protocols to distinguish cytoplasmic from lumenal domains

    • Combine with ER markers like mCherry-KDEL to confirm localization

  • Protease protection assays:

    • Prepare microsomes or semi-permeabilized cells expressing LMF1

    • Treat with proteases (trypsin, proteinase K) with or without detergent

    • Analyze protected fragments by western blotting using domain-specific antibodies

  • Glycosylation site mapping:

    • Introduce artificial N-glycosylation sites at various positions

    • Assess glycosylation status through gel mobility shifts or glycosidase sensitivity

    • Only lumenal domains will be glycosylated, confirming topology

  • Cysteine accessibility methods:

    • Generate cysteine-substituted variants at predicted boundary regions

    • Test accessibility to membrane-impermeable sulfhydryl reagents

    • Use mass spectrometry to identify modified positions

  • Computational prediction validation:

    • Compare experimental results with topology predictions from algorithms

    • Resolve discrepancies through additional targeted experiments

    • Build refined topology models incorporating all experimental constraints

These approaches can be combined to generate a comprehensive topology map, which is essential for interpreting functional studies and designing targeted mutations or truncations of bovine LMF1.

Table 1: Comparison of LMF1 Truncation Effects on LPL Activity

LMF1 ConstructDomain CompositionLPL Activity (%)LPL Specific ActivityLPL MassReference
Full-length LMF1All domains100NormalNormal
N-terminal truncationsMissing N-terminal domains0ReducedReduced
C-terminal truncation (Y439X)Missing C-terminal domain0ReducedNormal
TM3 truncationPartial transmembrane domains0ReducedReduced
TM5 truncationMost transmembrane domains0ReducedReduced

Table 2: Effects of LMF1 Overexpression on Tissue Lipase Activities in Transgenic Mice

Tissue TypeLMF1 OverexpressionLPL Activity ChangeLPL Mass ChangeLPL Specific Activity ChangeReference
Omental adiposeaP2-Lmf1IncreasedUnchangedIncreased
Subcutaneous adiposeaP2-Lmf1IncreasedUnchangedIncreased
Gonadal adiposeaP2-Lmf1IncreasedIncreasedUnchanged
HeartMck-Lmf1IncreasedIncreasedUnchanged
Muscle (female)Mck-Lmf1IncreasedUnchangedIncreased
Muscle (male)Mck-Lmf1IncreasedIncreasedUnchanged

Table 3: Key LMF1 Interacting Partners and Their Functions in Lipase Maturation

ProteinFunctionInteraction DomainEffect on LPL MaturationReference
UGGT1N-linked glycosylationNot specifiedImportant for folding
UGGT2N-linked glycosylationNot specifiedImportant for folding
ERp72OxidoreductaseNot specifiedProcesses proteins with multiple disulfide bonds
ERp44OxidoreductaseNot specifiedThiol-mediated retention
ERdj5OxidoreductaseNot specifiedReduces misfolded proteins
Thioredoxin (TRX)Cytosolic proteinNot specifiedReduces disulfide bonds

Table 4: Properties of Recombinant Human LMF1 Fragment (Met1~Leu207)

PropertyValueReference
SourceProkaryotic expression (E. coli)
TagsN-terminal His Tag
Subcellular LocationSecreted
Purity> 90%
Predicted Molecular Mass27.1 kDa
Actual Molecular Mass (SDS-PAGE)21 kDa
Predicted isoelectric point8.5
Buffer formulation20mM Tris, 150mM NaCl, pH8.0

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.