Recombinant Bovine Lipid phosphate phosphatase-related protein type 2 (LPPR2)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

LPPR2 (Lipid Phosphate Phosphatase-Related Protein Type 2), encoded by the PLPPR2 gene, is a member of the lipid phosphate phosphatase (LPP) family. These enzymes catalyze the dephosphorylation of bioactive lipid phosphates, such as lysophosphatidic acid (LPA) and phosphatidic acid (PA), which are critical for lipid signaling and membrane homeostasis . While the query specifies "Recombinant Bovine LPPR2," available literature focuses on the human ortholog. No bovine-specific studies or recombinant protein data were identified in the provided sources.

Protein Structure

FeatureDetail
Gene IDPLPPR2 (Gene ID: 64748)
Protein IDQ96GM1 (UniProt)
Molecular Weight~36.88 kDa (343 amino acids)
LocalizationIntegral plasma membrane component
Catalytic ActivityPredicted phosphatidate phosphatase activity (EC 3.1.3.4)

Key Domains:

  • LPPR Family Homology: Shares structural motifs with other LPPR proteins (e.g., LPPR1, LPPR3) but lacks Pfam domains .

  • Membrane Anchoring: Integral membrane protein with potential extracellular and intracellular domains .

Primary Activities

  • Phospholipid Dephosphorylation: Hydrolyzes lipid phosphates to regulate lipid signaling pathways .

  • Signal Transduction: Modulates signaling via interactions with mTOR and PTEN .

Cooperative Interactions

LPPR2 interacts with other LPPR family members (e.g., LPPR1, LPPR3, LPPR4, LPPR5) to form functional complexes :

PartnerInteraction TypeBiological Outcome
LPPR1Direct bindingEnhanced protein stability and membrane localization
LPPR3Co-expression synergyIncreased protein levels and S6 ribosomal phosphorylation
mTOR/PTENRegulatory complexModulation of cell proliferation and growth

Cancer Biology

  • Tumor Growth: Elevated LPP2 (a related LPP) expression correlates with oncogenesis, but LPPR2’s role remains unclear .

  • Lipid Raft Formation: PLPP2 (a homolog) promotes lipid raft synthesis, driving cell proliferation in lung adenocarcinoma .

Membrane Homeostasis

  • ER Stress Mitigation: FIT2 (a yeast homolog) prevents ER whorls via lipid phosphate phosphatase activity, suggesting conserved roles in membrane stability .

Enzymatic Activity

Recombinant FIT2 (a functional analog) exhibits:

SubstrateApparent K<sub>m</sub>V<sub>max</sub> (nmol/min/mg)
Phosphatidic acid50 µM16.4
LPA186 µM30.0

Data adapted from .

Recombinant Protein Availability

A partial recombinant human PLPPR2 protein (produced in E. coli) is commercially available:

ParameterDetail
SourceE. coli-expressed human PLPPR2
TagNot specified in sources
PurityHigh (manufacturer claim)
Price~US$306 (CSB-EP836219HU1)

Gaps and Future Directions

  1. Bovine-Specific Data: No studies on bovine LPPR2 were identified; research focuses on human orthologs.

  2. Mechanistic Insights: Direct enzymatic activity of PLPPR2 remains unconfirmed; inferred from homologs .

  3. Therapeutic Potential: Targeting LPPR family members (e.g., LPP2) in cancer warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PLPPR2; LPPR2; PRG4; Phospholipid phosphatase-related protein type 2; Lipid phosphate phosphatase-related protein type 2; Plasticity-related gene 4 protein; PRG-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PLPPR2
Target Protein Sequence
MAGGRPQLKRSFSIIPCFVFVEILLGELARAFFPAPPSAVPIIGESTIVSGACCRFSPPL RRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDR FVNDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSLCLA LLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSPWED LSQAPTMDSPLEKLSVAQEPEGCRSHSTPARLTPSKPQNCARRGHLIPNCVSSRAPAMCS SPRVPRPRLRSEPTPLPLPLPLPAPAPSQGPSPSSPGPGGPGGGGSRGRKLLLPTPLLRD LYTLSGLYPSPFHRDNFSPYLFASRDHLL
Uniprot No.

Target Background

Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Lipid Phosphate Phosphatase-2 and what are its main cellular functions?

Lipid Phosphate Phosphatase-2 (LPP2) belongs to a family of enzymes (LPP1-3) that dephosphorylate both extracellular and intracellular bioactive lipid phosphates and pyrophosphates. Research has established that LPP2 plays a significant role in promoting cell growth, and its expression is notably elevated across various malignancies, strongly indicating its function as a pro-tumorigenic factor .

The primary cellular functions of LPP2 include:

  • Regulation of lipid phosphate signaling through dephosphorylation activities

  • Promotion of cell proliferation via cell cycle regulation

  • Modulation of c-Myc expression, a critical oncogenic transcription factor

  • Influence on G1/S transition in the cell cycle

Methodological approaches for studying LPP2 function typically include gene knockout using CRISPR/Cas9, protein overexpression systems, enzyme activity assays with specific substrates, and correlation studies between LPP2 levels and cellular phenotypes in both normal and cancer contexts .

How is LPP2 expression measured in normal versus cancerous tissues?

LPP2 expression can be quantified at both mRNA and protein levels using complementary techniques that enable comparative analysis between normal and cancerous tissues. Research has demonstrated that LPP2 mRNA levels are significantly higher in multiple breast cancer subtypes including ER/PR positive, ER/HER2 positive, and triple negative tumors compared to normal breast tissue .

Standard methodological approaches include:

  • mRNA expression analysis:

    • Quantitative PCR (qPCR) with specific primers targeting LPP2

    • RNA sequencing for genome-wide expression profiling

    • In situ hybridization for spatial localization within tissue samples

  • Protein detection:

    • Western blotting with LPP2-specific antibodies

    • Immunohistochemistry on tissue sections

    • Tissue microarray analysis for high-throughput screening

Significant findings from current research reveal that LPP2 mRNA expression is elevated in multiple breast cancer cell lines including Hs-578T, MDA-MB-231, MCF7, and MDA-MB-468 when compared to non-malignant cells like Hs-578Bst, MCF10A, and MCF-12A . Furthermore, higher levels of LPP2 in breast tumors, hepatocellular carcinoma, pancreatic adenocarcinoma, and melanomas correlate with poorer patient survival, underscoring its clinical significance .

What strategies can be employed for producing recombinant bovine phosphatases for research?

Production of recombinant bovine phosphatases requires careful consideration of expression systems to ensure proper folding and functional activity. Drawing from methodologies used for other bovine proteins, several approaches can be employed:

Expression SystemAdvantagesLimitationsTypical Applications
E. coliCost-effective, rapid growth, high yieldLimited post-translational modificationsStructural studies, antibody production
Insect cellsBetter protein folding, some PTMsHigher cost, longer production timeFunctional assays, structural analysis
Mammalian cellsNative-like PTMs, proper foldingHighest cost, lower yieldIn vivo studies, therapeutic development
Cell-free systemsRapid production, no cell viability concernsLower yield, higher costPreliminary screening, toxic proteins

For structural studies similar to those performed with bovine prion proteins, researchers typically employ:

  • Gene cloning and vector construction:

    • Amplification from bovine tissue or gene synthesis

    • Cloning into expression vectors with appropriate tags (His, GST)

    • Incorporation of protease cleavage sites for tag removal

  • Protein expression optimization:

    • Temperature, induction conditions, and media composition

    • For isotope labeling (15N, 13C, 2H), specialized minimal media

    • Co-expression with chaperones for improved folding

  • Multi-step purification:

    • Affinity chromatography (Ni-NTA, glutathione)

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Quality control:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Activity assays for functional validation

These approaches have been successfully applied to bovine prion protein production for NMR and other structural studies , providing a methodological framework applicable to phosphatase proteins.

How can researchers effectively use CRISPR/Cas9 to study LPP2 function?

CRISPR/Cas9 technology offers powerful approaches for investigating LPP2 function through precise genetic manipulation. Recent research has successfully employed this technique to knock out LPP2 in multiple cell lines to study its role in cancer progression .

A comprehensive methodological approach includes:

  • Guide RNA design and validation:

    • Target early exons to ensure complete loss of function

    • Verify minimal off-target effects using prediction algorithms

    • Design multiple sgRNAs for redundancy and efficiency

  • Delivery optimization:

    • Plasmid-based transfection for stable modification

    • Ribonucleoprotein (RNP) complex delivery for transient editing

    • Lentiviral transduction for difficult-to-transfect cells

  • Clone selection and validation:

    • Single-cell isolation and expansion

    • Genomic DNA sequencing to confirm mutations

    • Western blotting to verify protein knockout

    • RT-qPCR to assess mRNA levels

  • Functional characterization:

    • Proliferation assays (MTT, EdU incorporation)

    • Cell cycle analysis using flow cytometry

    • Migration and invasion assays

    • In vivo tumor formation studies

Research has demonstrated that LPP2 knockout using CRISPR/Cas9 in breast cancer cells significantly decreases cell growth by inhibiting G1/S transition of the cell cycle . These effects are associated with changes in key cell cycle regulators including cyclin A2, cyclin B1, and cell cycle inhibitors p27 and p21 . Furthermore, LPP2 knockout in MDA-MB-231 or 4T1 cells suppressed tumor formation in mouse breast cancer models and decreased the in vivo expression of Ki67 and c-Myc .

What structural analysis techniques are most informative for studying recombinant bovine phosphatases?

Structural characterization of recombinant bovine phosphatases provides critical insights into function, substrate specificity, and potential for therapeutic targeting. Drawing from methodologies used in bovine prion protein studies, several techniques can be effectively applied:

  • NMR Spectroscopy:

    • Sample preparation with isotope labeling (15N, 13C)

    • 2D experiments (HSQC) for initial structural assessment

    • 3D experiments (NOESY, TOCSY) for complete structure determination

    • Chemical shift analysis for secondary structure identification

    • NOE distance constraints for 3D structure calculation

  • X-ray Crystallography:

    • Crystallization condition screening

    • Diffraction data collection

    • Phase determination and electron density mapping

    • Model building and refinement

  • Hydrogen-Deuterium Exchange:

    • Monitoring exchange rates of amide protons

    • Identification of protected regions indicating stable structure

    • Assessment of flexibility and dynamics

  • Biophysical characterization:

    • Circular dichroism for secondary structure content

    • Thermal stability measurements

    • Dynamic light scattering for oligomerization state

NMR studies of recombinant bovine prion protein revealed a well-defined globular domain (residues 125-227) containing three α-helices (residues 144-154, 173-194, and 200-226) and a short antiparallel β-sheet (residues 128-131 and 161-164) . The most stable regions were identified through hydrogen-deuterium exchange experiments and relaxation measurements, demonstrating differential stability across the protein structure .

For recombinant bovine phosphatases, similar approaches would allow identification of catalytic domains, substrate binding regions, and potential druggable pockets.

How should researchers design experiments to study the effect of LPP2 on tumor formation and metastasis?

Investigating LPP2's role in tumor formation and metastasis requires carefully designed in vitro and in vivo experiments. Based on successful research approaches, a comprehensive experimental design should include:

  • In vitro tumor characteristics assessment:

    • Proliferation assays comparing wild-type and LPP2 knockout cells

    • Colony formation in soft agar to measure anchorage-independent growth

    • 3D spheroid formation to mimic tumor architecture

    • Migration and invasion assays using transwell chambers

  • Cell signaling pathway analysis:

    • Western blotting for c-Myc and downstream targets

    • Quantification of cell cycle proteins (cyclins, CDK inhibitors)

    • Assessment of EMT markers (E-cadherin, vimentin)

    • Phosphorylation status of key signaling proteins

  • In vivo tumor models:

    • Orthotopic implantation for physiologically relevant tumor growth

    • Subcutaneous xenografts for rapid assessment of tumorigenicity

    • Metastasis models (tail vein injection, intracardiac injection)

    • Patient-derived xenografts for translational relevance

  • Analysis of tumor samples:

    • Tumor volume and weight measurements

    • Immunohistochemistry for proliferation markers (Ki67)

    • c-Myc expression quantification

    • Metastatic burden assessment

Research has demonstrated that LPP2 knockout in MDA-MB-231 cells significantly decreases breast tumor growth and lung metastasis in mouse xenograft models . Similarly, LPP2 knockout in 4T1 cells inhibited tumor growth in a mouse syngeneic model, providing compelling evidence for LPP2's role in promoting tumor progression .

How does LPP2 influence cell cycle regulation and c-Myc expression?

LPP2 has been identified as a significant regulator of cell cycle progression and c-Myc expression, with important implications for cancer development and progression. Understanding these mechanisms requires sophisticated experimental approaches:

  • Cell cycle analysis methodologies:

    • Cell synchronization using serum starvation or chemical inhibitors

    • Flow cytometry with propidium iodide staining for DNA content

    • EdU incorporation assays for S-phase quantification

    • Time-lapse imaging with fluorescent cell cycle reporters

  • c-Myc regulation assessment:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

    • Luciferase reporter assays for promoter activity

    • RNA stability measurements (actinomycin D chase)

    • Protein stability analysis (cycloheximide chase)

Research findings demonstrate that LPP2 knockout decreases cell growth by specifically inhibiting the G1/S transition of the cell cycle . This effect is associated with changes in key cell cycle regulators including cyclin A2, cyclin B1, and cell cycle inhibitors p27 or p21 . Importantly, the level of c-Myc is downregulated when LPP2 is knocked out, and can be partially restored by re-expressing LPP2 .

A significant positive correlation between LPP2 and c-Myc expression has been observed across multiple cancer types including breast, lung, upper aerodigestive tract, and urinary tract cancers . This consistent relationship suggests a conserved regulatory mechanism that could be therapeutically targeted.

What challenges exist in developing specific inhibitors for LPP2?

Developing specific inhibitors for LPP2 represents a promising therapeutic strategy but faces several challenges that require systematic research approaches:

  • Structural challenges:

    • High homology between LPP family members complicates specificity

    • Limited structural information on substrate binding sites

    • Potential conformational changes during catalytic cycle

  • Methodological approaches for inhibitor development:

    • Structure-based design utilizing homology models

    • Fragment-based screening with NMR or X-ray crystallography

    • High-throughput enzymatic assays with fluorescent substrates

    • Cellular thermal shift assays (CETSA) for target engagement

  • Specificity validation:

    • Counter-screening against related phosphatases

    • Selectivity profiling across phosphatase families

    • Cellular pathway analysis to confirm on-target effects

    • CRISPR knockout controls to verify inhibitor specificity

  • Delivery optimization:

    • Assessment of physicochemical properties for cell permeability

    • Lipid nanoparticle formulations for in vivo delivery

    • Targeted delivery strategies to minimize off-target effects

Research demonstrating LPP2's role in promoting tumor growth through c-Myc regulation suggests that targeting LPP2 could provide a novel strategy for cancer therapy, particularly in tumors where c-Myc is a key driver . The development of specific LPP2 inhibitors would enable validation of this therapeutic approach.

How can researchers develop specific antibodies against bovine phosphatases?

Development of specific antibodies against bovine phosphatases requires careful consideration of antigen design, immunization strategies, and rigorous validation:

  • Antigen design strategies:

    • Recombinant full-length protein expression

    • Synthetic peptides targeting unique epitopes

    • Protein fragments focusing on non-conserved regions

  • Immunization approaches:

    • Selection of appropriate host species (considering evolutionary conservation)

    • Adjuvant selection to enhance immunogenicity

    • Prime-boost protocols with optimal timing

  • Antibody production methods:

    • Polyclonal antibody generation from immunized animals

    • Monoclonal antibody development using hybridoma technology

    • Recombinant antibody production via phage display

  • Validation procedures:

    • Western blotting with specific positive and negative controls

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate tissues

    • ELISA for quantitative binding assessment

Research with bovine prion protein has demonstrated that even for highly conserved proteins, specific antibodies can be successfully generated. By immunizing wild-type BALB/c mice with chemically unmodified recombinant bovine PrP, researchers achieved a potent humoral immune response and isolated monoclonal antibodies specifically reacting with bovine and human PrP . The resulting antibodies were useful for both research and diagnostic applications .

For bovine phosphatases, similar approaches could yield specific antibodies targeting unique epitopes, enabling detailed studies of expression, localization, and function.

How should researchers interpret survival data related to LPP2 expression in cancer patients?

Proper analysis and interpretation of survival data in relation to LPP2 expression requires robust statistical approaches and careful consideration of confounding factors:

  • Statistical methodologies:

    • Kaplan-Meier survival analysis with log-rank tests

    • Cox proportional hazards regression for multivariate analysis

    • Competing risk analysis when multiple outcomes are possible

    • Determination of appropriate cutoff values for high vs. low expression

  • Data visualization approaches:

    • Survival curves stratified by expression levels

    • Forest plots for multivariate hazard ratios

    • Nomograms incorporating LPP2 with clinical variables

    • Time-dependent ROC curves for prognostic performance

  • Validation strategies:

    • Training/validation cohort division

    • External dataset validation

    • Cross-validation techniques

    • Sensitivity analysis with different expression cutoffs

  • Interpretation considerations:

    • Distinction between correlation and causation

    • Assessment of independence from established prognostic factors

    • Evaluation of subgroup effects (cancer subtypes, treatments)

    • Integration with functional data on LPP2 biology

Research has demonstrated that higher levels of LPP2 in breast tumors, hepatocellular carcinoma, pancreatic adenocarcinoma, and melanomas correlate with poorer survival outcomes . This consistent pattern across multiple cancer types strongly suggests a functional role for LPP2 in cancer progression rather than a mere biomarker association.

What approaches can be used to analyze the correlation between LPP2 and c-Myc expression?

The correlation between LPP2 and c-Myc expression represents a critical regulatory axis in cancer biology that requires sophisticated analytical approaches:

  • Correlation analysis methodologies:

    • Pearson or Spearman correlation coefficients

    • Linear regression models with appropriate transformations

    • Multivariate regression controlling for confounding factors

    • Mutual information analysis for non-linear relationships

  • Multi-omics integration:

    • Correlation across transcriptomic, proteomic, and functional data

    • Network analysis to identify common regulatory mechanisms

    • Pathway enrichment analysis for shared biological processes

    • Causality inference using intervention data (knockout/overexpression)

  • Single-cell analysis approaches:

    • Co-expression patterns at single-cell resolution

    • Trajectory analysis to identify temporal relationships

    • Spatial transcriptomics for tissue context assessment

    • Cellular heterogeneity characterization

  • Clinical data integration:

    • Stratification of patient outcomes by combined expression patterns

    • Development of composite biomarkers incorporating both factors

    • Treatment response prediction based on expression profiles

Research has identified a positive correlation between LPP2 and c-Myc expression across multiple cancer cell lines including breast, lung, upper aerodigestive tract, and urinary tract cancers . This relationship is further supported by functional studies showing that LPP2 knockout downregulates c-Myc levels, while re-expression of LPP2 partially restores c-Myc expression . These findings suggest a mechanistic link that warrants further investigation as a potential therapeutic target.

What emerging technologies might advance our understanding of LPP2 function?

Emerging technologies offer new opportunities to deepen our understanding of LPP2 function and its therapeutic targeting:

  • Advanced genetic engineering approaches:

    • CRISPR base editing for precise mutation introduction

    • CRISPR activation/interference for endogenous gene modulation

    • Prime editing for specific sequence replacements

    • Inducible degradation systems for temporal control

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane-associated complexes

    • Integrative structural biology combining multiple data sources

    • Molecular dynamics simulations for functional insights

    • Fragment screening by crystallography or NMR

  • Single-cell and spatial technologies:

    • Single-cell multi-omics for comprehensive profiling

    • Spatial transcriptomics for tissue context understanding

    • Live-cell imaging with biosensors for real-time activity

    • Mass cytometry for high-dimensional protein analysis

  • Advanced in vivo models:

    • Patient-derived organoids for personalized studies

    • Humanized mouse models for improved translation

    • CRISPR-engineered mouse models with conditional alleles

    • Barcoding approaches for clonal analysis in vivo

These technologies could help address key questions about LPP2's precise molecular mechanisms, its interaction with c-Myc regulatory pathways, and its potential as a therapeutic target in cancer . The strong connection between LPP2, cell cycle regulation, and c-Myc expression provides a compelling foundation for these future investigations.

How might targeting LPP2 complement existing cancer therapies?

Targeting LPP2 represents a promising approach that could enhance existing cancer therapies through multiple mechanisms:

  • Combination therapy rationales:

    • Sensitization to chemotherapy through cell cycle effects

    • Enhancement of targeted therapies affecting related pathways

    • Overcoming resistance mechanisms involving c-Myc

    • Improving immunotherapy responses through tumor microenvironment modulation

  • Preclinical evaluation approaches:

    • In vitro drug combination studies (synergy calculation)

    • Genetic interaction screens to identify synthetic lethality

    • In vivo combination studies in appropriate animal models

    • Mechanistic studies of pathway interactions

  • Biomarker development strategies:

    • Identification of patient populations likely to benefit

    • Development of pharmacodynamic markers for target engagement

    • Resistance mechanism prediction through molecular profiling

    • Real-time monitoring of treatment response

  • Therapeutic modality considerations:

    • Small molecule inhibitors targeting catalytic activity

    • Protein degradation approaches (PROTACs)

    • RNA interference strategies for expression modulation

    • Antibody-based approaches for specific targeting

Research demonstrating that LPP2 knockout decreases c-Myc expression and inhibits tumor growth provides a strong rationale for therapeutic targeting . Since c-Myc is a critical oncogenic driver that has proven challenging to target directly, LPP2 inhibition could represent an alternative approach to modulate c-Myc-dependent processes in cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.