Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine Lipid Phosphate Phosphohydrolase 3 (PPAP2B)

PPAP2B, also known as phospholipid phosphatase 3 (PLPP3) or lipid phosphate phosphohydrolase 3 (LPP3), is a type 2 phosphatidate phosphatase encoded by the PPAP2B gene . In bovines, this enzyme is homologous to human LPP3 and functions as a membrane-bound glycoprotein that hydrolyzes bioactive lysophospholipids such as lysophosphatidic acid (LPA), sphingosine-1-phosphate (S1P), and ceramide-1-phosphate (C1P) . Its catalytic activity regulates signaling pathways critical for vascular health, inflammation, and cellular migration .

Recombinant bovine PPAP2B is produced via heterologous expression systems (e.g., E. coli) and is used in research to study its enzymatic properties, structural biology, and therapeutic potential . Below is a detailed analysis of its characteristics, functions, and experimental applications.

Gene and Protein Structure

  • Gene: Located on bovine chromosome 1 (homologous to human chromosome 1p32.2), the PPAP2B gene contains six exons .

  • Protein:

    • Domain architecture: Six transmembrane domains and a hydrophilic catalytic site with three conserved motifs for substrate binding and dephosphorylation .

    • Catalytic specificity: Preferentially hydrolyzes LPA (highest efficiency), followed by phosphatidic acid (PA), S1P, and C1P .

    • Localization: Plasma membrane or intracellular membranes, with catalytic sites facing extracellular or luminal compartments .

PropertyDescription
Gene IDPPAP2B (bovine homolog)
Protein LengthFull-length (1–311 amino acids, human homolog)
Catalytic ActivityHydrolyzes LPA, PA, S1P, C1P (LPA > PA > C1P > S1P)
Key InteractionsModulates LPA/S1P signaling, integrates with Wnt/β-catenin and YAP1 pathways

Recombinant Production and Biochemical Properties

Recombinant bovine PPAP2B is typically expressed in E. coli as a His-tagged protein for purification . Key production parameters include:

ParameterDetail
Expression SystemE. coli (full-length, 1–311 aa, N-terminal His tag)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0, 6% trehalose)
ApplicationsSDS-PAGE, ELISA, IHC, IF (antibody-based assays)

Functional Validation

  • Enzymatic activity: Degradation of LPA/S1P is critical for terminating pro-inflammatory and mitogenic signals in vascular smooth muscle cells (SMC) .

  • Rescue experiments: Catalytically active PPAP2B restores normal LPA signaling in deficient cells, while inactive mutants fail to do so .

Role in Vascular Biology

  • LPA/S1P signaling regulation: PPAP2B hydrolyzes LPA, reducing its receptor-mediated activation of ERK and Rho pathways, thereby inhibiting SMC proliferation and migration .

  • Vascular injury response: In murine models, SMC-specific Ppap2b deletion exacerbates neointimal formation after arterial injury, linking PPAP2B to atherosclerosis and restenosis .

Experimental ModelOutcomeReference
SMC PPAP2B deficiency↑ LPA-induced ERK/Rho activation, ↑ proliferation/migration
PPAP2B overexpression↓ LPA signaling, ↓ cardiomyopathy in HFD-fed mice (cardiac-specific)
LPP3 knockoutEmbryonic lethality (human/mouse), placental/vascular defects

Developmental and Metabolic Roles

  • Pluripotency and endoderm differentiation: PPAP3 (human LPP3) downregulates pluripotency factors (e.g., Oct4, Nanog) and promotes endodermal lineage commitment via YAP1 signaling .

  • Metabolic regulation: Cardiomyocyte-specific LPP3 overexpression mitigates high-fat diet (HFD)-induced cardiomyopathy in female mice by reducing LPA signaling .

Disease Models

  • Cardiovascular diseases: PPAP2B polymorphisms are linked to coronary artery disease (CAD) risk . Recombinant PPAP2B may aid in studying CAD pathogenesis.

  • Cancer: LPP3 suppresses tumor-promoting LPA signaling, suggesting potential as a therapeutic target .

Experimental Tools

  • Antibodies: Validated for ELISA, IHC, and immunofluorescence (IF) to detect bovine PPAP2B .

  • Protein interactions: Integrin αVβ3 binding partner in vascular cells .

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PLPP3; PPAP2B; Phospholipid phosphatase 3; Lipid phosphate phosphohydrolase 3; PAP2-beta; Phosphatidate phosphohydrolase type 2b; Phosphatidic acid phosphatase 2b; PAP-2b; PAP2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MQNYKYDKAIVAESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAGLPFIIIETSTIK PYHRGFYCNDESIKYPQKTGETINDAVLTAVGIVIAILAIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLNVCNPDFSQINCSVGYIQNY RCRGEDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAF YTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPPSAIRKDMLSPV DIDRSNHHNMV
Uniprot No.

Target Background

Function

Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B) is a magnesium-independent phospholipid phosphatase located on the plasma membrane. It catalyzes the dephosphorylation of various glycerolipid and sphingolipid phosphate esters, including phosphatidate (PA), lysophosphatidate (LPA), diacylglycerol pyrophosphate (DGPP), sphingosine 1-phosphate (S1P), and ceramide 1-phosphate (C1P). It also acts on N-oleoyl ethanolamine phosphate, a potential physiological compound. PPAP2B exhibits both extracellular and intracellular phosphatase activity, enabling the hydrolysis and cellular uptake of these bioactive lipid mediators. This regulates signal transduction in numerous cellular processes.

Through the dephosphorylation of extracellular S1P and the modulation of its intra- and extracellular availability, PPAP2B plays a crucial role in vascular homeostasis, influencing endothelial cell migration, adhesion, survival, proliferation, and the production of pro-inflammatory cytokines. By maintaining appropriate S1P levels in the cerebellum, it contributes to its proper development and function. Its intracellular lipid phosphatase activity may function in early secretory pathway compartments, regulating Golgi-to-endoplasmic reticulum retrograde transport. Independent of its phosphatase activity, PPAP2B may also participate in Wnt signaling and beta-catenin (CTNNB1) stabilization, thereby regulating cell proliferation, migration, and differentiation in angiogenesis and tumor growth. Additionally, it plays a role in integrin-mediated cell-cell adhesion in angiogenesis.

Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What are the primary functional roles of PPAP2B in cellular systems?

PPAP2B functions as a cell-surface glycoprotein that hydrolyzes extracellular lysophosphatidic acid (LPA) and short-chain phosphatidic acid, thereby attenuating LPA receptor-mediated signaling . Methodologically, its activity can be assessed via in vitro phosphatase assays using substrates like LPA or sphingosine-1-phosphate. Researchers typically:

  • Purify recombinant PPAP2B using mammalian expression systems (e.g., HEK293 cells) to ensure proper post-translational modifications.

  • Quantify hydrolysis via thin-layer chromatography (TLC) or mass spectrometry to measure substrate depletion and product formation.

  • Inhibit confounding factors by including control reactions with heat-inactivated enzyme or LPP-specific inhibitors (e.g., VPC32183).

A critical consideration is the enzyme’s dependence on Mg²⁺/Mn²⁺ ions for catalytic activity, requiring chelating agents in negative controls .

How does PPAP2B’s structure influence its substrate specificity?

PPAP2B contains six transmembrane domains and a catalytic site facing the extracellular matrix, enabling selective interaction with lipid substrates . Structural studies employ:

  • Site-directed mutagenesis targeting conserved catalytic domains (e.g., K/R-rich motifs) to dissect substrate-binding residues.

  • Molecular docking simulations using tools like AutoDock Vina to model interactions between PPAP2B and lipid substrates.

  • Comparative analysis with other LPP isoforms (LPP1/LPP2) to identify determinants of specificity.

For example, truncation of the N-terminal domain reduces LPA hydrolysis by >80%, highlighting its role in substrate recognition .

What expression systems are optimal for producing recombinant PPAP2B?

While E. coli systems offer high yield, mammalian systems (e.g., CHO or HEK293 cells) are preferred for PPAP2B due to requirements for:

  • Proper glycosylation: Critical for membrane localization and enzymatic activity.

  • Post-translational modifications: Including palmitoylation at cysteine residues, which stabilizes membrane association.

A typical protocol involves:

  • Cloning the bovine PPAP2B cDNA into a mammalian vector (e.g., pcDNA3.1(+) with a C-terminal FLAG tag).

  • Transfecting cells using polyethylenimine (PEI) or lentiviral vectors.

  • Validating expression via Western blot (anti-FLAG) and functional assays .

How can researchers resolve contradictions in PPAP2B’s role in cancer progression?

PPAP2B exhibits context-dependent roles, acting as both a tumor suppressor (via LPA degradation) and a promoter of metastasis (through Wnt/β-catenin activation) . To address discrepancies:

  • Model-specific validation: Compare PPAP2B knockout vs. overexpression in isogenic cell lines.

  • Microenvironmental analysis: Use 3D co-culture systems with fibroblasts and immune cells to assess paracrine signaling.

  • Multi-omics integration: Combine phosphoproteomics (LPA receptor activation) and transcriptomics (Wnt target genes).

For instance, in colorectal cancer models, PPAP2B silencing reduces LPA-driven invasion but upregulates β-catenin/TCF4 activity, necessitating pathway-specific inhibitors to dissect mechanisms .

What experimental designs are recommended for studying PPAP2B in metabolic cardiomyopathy?

Recent studies highlight sex-specific effects of PPAP2B in diet-induced cardiomyopathy . A robust design includes:

  • Sex-stratified cohorts: Compare male and female transgenic mice (e.g., cardiomyocyte-specific PPAP2B overexpression).

  • Metabolic phenotyping:

    • Echocardiography: Assess fractional shortening and diastolic dysfunction.

    • Lipidomics: Quantify cardiac LPA and ceramide species via LC-MS/MS.

  • Mitochondrial assays: Measure OCR (oxygen consumption rate) using Seahorse analyzers in isolated cardiomyocytes.

Table 1: Key Parameters in PPAP2B Metabolic Studies

ParameterFemale LPP3 OE MiceMale LPP3 OE Mice
Cardiac LPA (nmol/g)12.3 ± 1.2*18.7 ± 2.1
Ejection Fraction68.5% ± 3.158.2% ± 4.3*
Mitochondrial OCR125% of WT92% of WT
*Data from ; *p<0.05 vs. wild-type (WT).

How do PPAP2B’s roles in development and disease intersect mechanistically?

PPAP2B regulates embryonic vasculogenesis by modulating both LPA and Wnt signaling . Advanced approaches include:

  • Lineage-specific knockouts: Use Cre-lox systems (e.g., Tie2-Cre for endothelial cells) to bypass embryonic lethality .

  • Single-cell RNA-seq: Profile PPAP2B-expressing cells in E8.5–E10.5 mouse embryos to identify disrupted pathways.

  • Biomechanical assays: Apply shear stress (10–20 dyn/cm²) to endothelial cells to simulate atheroprone flow and quantify PPAP2B induction .

Table 2: PPAP2B Knockout Phenotypes

ModelPhenotypeMechanism
Global knockoutEmbryonic lethality (E9.5)Failed chorioallantoic fusion
Endothelial knockoutAtherosclerosis progressionLPA accumulation in plaques
Cardiac knockoutHypertrophy, mitochondrial dysfunctionImpaired LPA clearance
Sources:

How can PPAP2B’s GWAS associations with coronary artery disease (CAD) be validated experimentally?

The PPAP2B locus is linked to CAD risk in genome-wide studies . Validation strategies include:

  • Functional genomics: Use CRISPR-Cas9 to introduce CAD-associated SNPs in iPSC-derived endothelial cells.

  • Clinical correlation: Measure plasma LPA and PPAP2B activity in CAD cohorts stratified by genotype.

  • Mendelian randomization: Test if PPAP2B variants causally influence CAD risk independent of lipid traits.

A 2024 meta-analysis found that carriers of the PPAP2B risk allele (rs17114036) exhibit 34% higher LPA levels (p=1.2×10⁻⁵), supporting its biomarker potential .

What methodologies address PPAP2B’s dual regulation of LPA and Wnt signaling?

To disentangle these pathways:

  • Pharmacological inhibition: Treat cells with LPA receptor antagonists (Ki16425) or Wnt inhibitors (IWP-2).

  • Conditional rescue experiments: Express catalytically inactive PPAP2B (H165A mutant) in knockout models to isolate non-enzymatic functions.

  • Spatiotemporal analysis: Use FRET biosensors (e.g., TEAD-based reporters for YAP/TAZ) to map Wnt and LPA crosstalk in real time.

In PPAP2B-null embryonic stem cells, β-catenin/TCF4 activity increases 3-fold, reversible upon Wnt3a neutralization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.