Recombinant Bovine Lipoma HMGIC fusion partner-like 4 protein (LHFPL4)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Conservation

LHFPL4 belongs to the LHFP gene family, characterized by four transmembrane domains and conserved extracellular loops. The bovine LHFPL4 (UniProt ID: 540541) shares high sequence homology with human (Q7Z7J7) and murine isoforms, particularly in critical functional domains . A recombinant human LHFPL4 protein (Proteintech Ag15349) provides a structural blueprint:

ParameterDetails
Amino Acid SequenceIncludes residues 197–247 (LGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP)
TagGST (Glutathione S-transferase)
Production SystemE. coli (PET28a vector)
Purity≥90% (SDS-PAGE)
FormulationLyophilized with 5% trehalose and 5% mannitol for stability

This structure suggests conserved roles in protein-protein interactions, particularly with GABA<sub>A</sub> receptors (GABA<sub>A</sub>Rs) and synaptic scaffolding proteins like gephyrin .

Functional Roles in Synaptic Regulation

LHFPL4 is essential for inhibitory synapse formation and GABA<sub>A</sub>R clustering. Key findings include:

  • GABA<sub>A</sub>R Interaction: Direct binding to GABA<sub>A</sub>R-α/γ subunits stabilizes receptors at postsynaptic sites .

  • Cell-Type Specificity: Critical for GABA<sub>A</sub>R clustering in hippocampal pyramidal neurons but not interneurons .

  • Synaptic Aggregation: Loss of LHFPL4 disrupts gephyrin scaffold assembly, leading to intracellular aggregates and reduced inhibitory currents .

Production and Biochemical Properties

Recombinant LHFPL4 is typically produced in E. coli systems for high yield and purity. While bovine-specific protocols are not explicitly documented, methods for human LHFPL4 (e.g., Proteintech’s GST-tagged protein) are instructive :

StepDescription
CloningcDNA encoding bovine LHFPL4 fused to GST in a PET28a vector.
ExpressionInduced with IPTG in BL21(DE3) E. coli strains.
PurificationAffinity chromatography using glutathione resin, followed by size-exclusion chromatography.
Quality ControlSDS-PAGE and Western blotting with anti-GST/LHFPL4 antibodies.

Research Applications

Recombinant LHFPL4 facilitates studies on:

  • Synaptic Plasticity: Investigating GABA<sub>A</sub>R trafficking deficits in neurological disorders (e.g., epilepsy) .

  • Chemical Modulation: Screening activators like retinoic acid and forskolin, which may upregulate LHFPL4 expression in sensory tissues .

  • Toxicology: Assessing environmental toxins (e.g., bisphenol A, arsenic) that alter LHFPL4 methylation or expression .

Regulatory and Pathological Implications

  • Epigenetic Regulation: Methylation changes in the LHFPL4 promoter correlate with exposure to aflatoxin B1 and arsenic .

  • Therapeutic Targets: Potential role in treating sensory deficits linked to inner ear or retinal dysfunction .

Challenges and Future Directions

  • Species-Specificity: Functional differences between bovine and human isoforms remain underexplored.

  • Structural Studies: Cryo-EM or X-ray crystallography of bovine LHFPL4-GABA<sub>A</sub>R complexes could clarify interaction mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHFPL4; LHFPL tetraspan subfamily member 4 protein; Lipoma HMGIC fusion partner-like 4 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
LHFPL4
Target Protein Sequence
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG LFHYCVGSGLAGRELTCRGSFTDFSTIPSGAFKAAAFFVLLSMVLILGCITCFALFFFCN TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA IIGILNALILSFLAFVLGNRQTDLLQEELKQENKDFVGSTVSSVLRPGGDVSGWGVLPCP VAHTQGP
Uniprot No.

Target Background

Function
This protein plays a regulatory role in inhibitory synapse formation and function. It contributes to maintaining gamma-aminobutyric acid receptor (GABAAR) clustering and their associated scaffold proteins at inhibitory synaptic sites, working in conjunction with NLGN2 to recruit or stabilize GABAARs.
Database Links
Protein Families
LHFP family
Subcellular Location
Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is LHFPL4 and what protein family does it belong to?

LHFPL4 (Lipoma HMGIC Fusion Partner-Like 4) is a member of the LHFP gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. It functions as a critical regulatory protein enriched at inhibitory synapses in the central nervous system. The protein consists of 247 amino acid residues and contains multiple transmembrane domains characteristic of tetraspanin proteins . LHFPL4 forms tight interactions with GABA-A receptor subunits and is selectively concentrated at inhibitory synaptic sites, suggesting its specialized role in inhibitory neurotransmission .

What is the cellular localization of LHFPL4?

LHFPL4 demonstrates exquisite targeting to inhibitory synapses. Using laser scanning confocal microscopy (LSCM), researchers have observed that LHFPL4 forms discrete membrane clusters on neuronal soma and dendrites. These clusters robustly colocalize with inhibitory postsynaptic markers such as gephyrin and are positioned adjacent to vesicular GABA transporter (VGAT)-labeled inhibitory presynaptic terminals . Importantly, structured illumination microscopy (SIM) has revealed that LHFPL4 forms groups of nano-clusters overlaying gephyrin puncta, further supporting its inhibitory postsynaptic localization. Quantitative analysis has demonstrated that LHFPL4 is approximately 6-fold more enriched at inhibitory compared to excitatory synapses .

What are the known protein interactions of LHFPL4?

LHFPL4 forms high-affinity interactions with multiple proteins involved in inhibitory neurotransmission:

  • GABA-A receptor subunits (α1, α2, β3, and γ2): Co-immunoprecipitation experiments in both heterologous expression systems and brain tissue have confirmed direct interaction between LHFPL4 and various GABA-A receptor subunits .

  • Gephyrin: This inhibitory postsynaptic scaffolding protein co-immunoprecipitates with LHFPL4 from brain lysates, indicating they exist in the same protein complex .

  • Neuroligin2: LHFPL4 can be co-immunoprecipitated with this inhibitory synapse adhesion molecule, suggesting they form native complexes in vivo .

These interactions position LHFPL4 as a key component of the inhibitory postsynaptic complex essential for proper GABA-A receptor clustering.

What phenotypes are observed in LHFPL4 knockout models?

LHFPL4 knockout mice (Lhfpl4−/−) display several key phenotypes at the cellular and molecular levels:

  • Dramatic reduction in both gephyrin and GABA-A receptor-γ2 clustering in hippocampal neurons

  • Marked decrease in VGAT-positive clusters co-labeled for gephyrin

  • Preservation of inhibitory presynaptic terminals (VGAT alone) and excitatory synapses (homer)

  • Formation of large aggregates of mis-localized gephyrin within the soma and dendrites

  • Significant decrease in GAD6/gephyrin-positive clusters

  • Cell-type specific effects: GABAergic synaptic inputs on CA1 pyramidal neurons, but not interneurons, are affected

Functionally, loss of LHFPL4 leads to a profound reduction (~60%) in miniature inhibitory postsynaptic currents (mIPSCs) in hippocampal neurons, indicating significant impairment of inhibitory neurotransmission .

How does LHFPL4 regulate GABA-A receptor clustering at inhibitory synapses?

LHFPL4 plays a specialized role in synaptic targeting rather than surface trafficking of GABA-A receptors. In LHFPL4 knockout neurons, GABA-A receptors can still reach the cell surface but lose their synaptic clustering, appearing as diffuse surface fluorescence rather than discrete puncta . This distinct pattern was visualized using super-ecliptic pHluorin (SEP)-tagged GABA-A receptor subunits, which selectively fluoresce when inserted into the plasma membrane.

Mechanistically, LHFPL4 appears to function as a molecular bridge between GABA-A receptors and the postsynaptic scaffold. Unlike certain inhibitory postsynaptic transmembrane molecules (e.g., neuroligin2), LHFPL4 does not possess synaptogenic properties when overexpressed in non-neuronal cells co-cultured with neurons, indicating it functions primarily in receptor stabilization rather than synapse formation . The precise molecular mechanisms by which LHFPL4 anchors GABA-A receptors at synaptic sites remain an active area of investigation, but likely involve its interactions with both receptor subunits and scaffolding proteins like gephyrin.

What cell-type specificity exists in LHFPL4 function?

A remarkable finding regarding LHFPL4 is its cell-type specific function within the hippocampus. While LHFPL4 deletion profoundly affects GABA-A receptor clustering in excitatory pyramidal neurons, inhibitory interneurons appear largely unaffected . This selective dependency was demonstrated by comparing GABA-A receptor-γ2 clustering in CAMKIIα-positive excitatory neurons versus GAD6-positive inhibitory neurons from LHFPL4 knockout mice.

This cell-type specificity suggests that distinct molecular mechanisms regulate inhibitory synapse formation and maintenance in different neuronal populations. Interneurons may utilize alternative tetraspanins or entirely different protein complexes to cluster GABA-A receptors at their inhibitory synapses. This finding has important implications for understanding how inhibitory circuit function might be differentially affected in pathological conditions involving LHFPL4 dysfunction.

What is the relationship between LHFPL4 and gephyrin in inhibitory postsynaptic organization?

The relationship between LHFPL4 and gephyrin appears bidirectional and interdependent. In LHFPL4 knockout mice, there is not only a loss of synaptic gephyrin clusters but also the formation of large intracellular gephyrin aggregates . This suggests that LHFPL4 is critical for proper gephyrin localization at the postsynaptic membrane.

Importantly, overexpression of LHFPL4 in knockout neurons can rescue gephyrin clustering defects, demonstrating a direct functional relationship between these proteins . The molecular mechanisms underlying this relationship may involve:

  • Direct or indirect physical interactions between LHFPL4 and gephyrin

  • LHFPL4-mediated stabilization of surface GABA-A receptors, which in turn anchor gephyrin

  • LHFPL4-dependent recruitment of additional factors that regulate gephyrin clustering

Understanding the precise hierarchy and chronology of LHFPL4 and gephyrin recruitment to inhibitory synapses remains an important research question.

How do mutations in LHFPL4 affect inhibitory synaptic transmission?

Mutations in LHFPL4 have profound functional consequences for inhibitory neurotransmission. Electrophysiological recordings from LHFPL4 knockout neurons reveal a ~60% reduction in miniature inhibitory postsynaptic current (mIPSC) charge transfer compared to wild-type neurons . This functional deficit aligns with the observed loss of synaptic GABA-A receptor clusters and reflects impaired inhibitory synaptic transmission.

Of note, considerable variability in mIPSC amplitude and frequency exists even within knockout preparations, likely reflecting the cell-type specific effects of LHFPL4 deletion . Further studies using conditional knockout approaches in specific neuronal populations could help resolve how LHFPL4 mutations differentially impact various components of inhibitory circuits.

What techniques are effective for studying LHFPL4 protein interactions?

Several complementary biochemical and imaging approaches have proven effective for investigating LHFPL4 protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique has successfully demonstrated interactions between LHFPL4 and GABA-A receptor subunits, gephyrin, and neuroligin2. Both overexpressed proteins in heterologous systems and endogenous proteins from brain tissue can be used .

  • Proximity Ligation Assay (PLA): While not explicitly mentioned in the search results, this technique is valuable for detecting protein-protein interactions in situ with high sensitivity and specificity. It would be particularly useful for confirming LHFPL4 interactions in native tissue.

  • Super-resolution microscopy: Structured Illumination Microscopy (SIM) has been successfully employed to visualize the nanoscale organization of LHFPL4 relative to other synaptic proteins, revealing LHFPL4 nano-clusters overlaying gephyrin puncta .

  • Fluorescence Resonance Energy Transfer (FRET): This approach could be useful for investigating the proximity and direct interaction between LHFPL4 and its binding partners in living neurons.

When designing interaction studies, it's critical to include appropriate negative controls and to validate findings using multiple independent methods.

What expression systems are optimal for producing recombinant bovine LHFPL4?

While the search results don't specifically address recombinant bovine LHFPL4 expression, several systems have been successfully used for mammalian LHFPL4 and similar tetraspanin proteins:

  • Mammalian expression systems: COS-7 cells have been used to express tagged versions of mouse and human LHFPL4 for interaction studies . HEK293 cells would also be suitable for producing properly folded mammalian tetraspanin proteins with appropriate post-translational modifications.

  • Baculovirus/insect cell systems: Though not specifically mentioned for LHFPL4, this system often provides higher yields of complex mammalian membrane proteins compared to bacterial systems while maintaining proper protein folding.

  • Cell-free expression systems: These can be effective for producing difficult-to-express membrane proteins and allow for direct incorporation into artificial lipid environments.

When expressing recombinant bovine LHFPL4, consider these factors:

  • Inclusion of affinity tags (His, FLAG, etc.) for purification

  • Fusion to fluorescent proteins (GFP, mCherry) for localization studies

  • Codon optimization for the chosen expression system

  • Addition of appropriate signal sequences if secretion is desired

What imaging techniques are most informative for LHFPL4 localization studies?

Multiple imaging modalities have proven valuable for studying LHFPL4 localization:

  • Laser Scanning Confocal Microscopy (LSCM): Effective for visualizing the distribution of LHFPL4 relative to synaptic markers in cultured neurons and brain sections. This approach has demonstrated LHFPL4 clustering at inhibitory synapses opposite VGAT-positive presynaptic terminals .

  • Structured Illumination Microscopy (SIM): This super-resolution technique has revealed the nanoscale organization of LHFPL4, showing it forms groups of nano-clusters overlaying gephyrin puncta . SIM overcomes the resolution limit of conventional fluorescence microscopy (~200 nm) to provide ~100 nm resolution.

  • Live-cell imaging with pH-sensitive tags: Super-ecliptic pHluorin (SEP) tags have been used to specifically visualize surface-expressed GABA-A receptors in the presence or absence of LHFPL4, demonstrating its role in receptor clustering rather than trafficking .

For quantitative analysis of LHFPL4 localization, researchers have successfully employed:

  • Line scan analysis through synaptic puncta to demonstrate peak fluorescence overlap with postsynaptic markers

  • Colocalization analysis with specific markers to determine enrichment at different synapse types

  • Cluster analysis to quantify changes in size, number, and intensity of LHFPL4-positive puncta

What functional assays can measure the impact of LHFPL4 manipulation?

Several functional approaches have been employed to assess how LHFPL4 affects inhibitory neurotransmission:

  • Electrophysiological recordings: Whole-cell patch-clamp recordings measuring miniature inhibitory postsynaptic currents (mIPSCs) have revealed a ~60% reduction in synaptic charge transfer in LHFPL4 knockout neurons . This approach directly quantifies the functional impact of LHFPL4 deletion on inhibitory synaptic transmission.

  • Molecular replacement strategies: Rescue experiments using LHFPL4 overexpression in knockout neurons have demonstrated the specificity of the observed phenotypes and can be combined with structure-function studies using mutated versions of LHFPL4 .

  • Synaptogenic assays: The "artificial synapse formation" or "hemi-synapse" assay, where non-neuronal cells expressing candidate synaptogenic molecules are co-cultured with neurons, has revealed that LHFPL4 does not possess synaptogenic properties unlike neuroligin2 .

  • Surface receptor labeling: Antibodies recognizing extracellular epitopes of GABA-A receptors have been used to specifically label surface receptors in living neurons, allowing assessment of how LHFPL4 affects receptor localization .

How can LHFPL4 research contribute to understanding neurological disorders?

Given LHFPL4's critical role in inhibitory synapse function, investigating its involvement in neurological disorders characterized by excitatory/inhibitory imbalance presents valuable research opportunities:

  • Epilepsy: Disruptions in GABAergic inhibition are implicated in various forms of epilepsy. LHFPL4 dysfunction could potentially contribute to epileptogenesis by reducing inhibitory control over neuronal circuits .

  • Autism Spectrum Disorders: Many autism-associated genes encode synaptic proteins, including those involved in inhibitory transmission. Investigating LHFPL4's role in models of autism could reveal new insights into disease mechanisms.

  • Anxiety disorders: GABAergic dysfunction is implicated in anxiety. The cell-type specific effects of LHFPL4 on inhibitory transmission might contribute to circuit-level imbalances involved in anxiety disorders.

Researchers could approach these questions by:

  • Screening for LHFPL4 mutations or expression changes in patient cohorts

  • Examining behavioral phenotypes in LHFPL4 knockout or mutant mice

  • Investigating interactions between LHFPL4 and known disease-associated proteins

What experimental systems are suitable for studying the evolution of LHFPL4 function?

Comparative studies across species could illuminate the evolutionary conservation and specialization of LHFPL4 function:

  • Cross-species protein sequence analysis: Comparing LHFPL4 sequences across vertebrates could identify highly conserved domains likely critical for function. The protein consists of 247 residues in humans, providing ample sequence for evolutionary analysis .

  • Functional complementation studies: Testing whether LHFPL4 from different species (including bovine LHFPL4) can rescue the deficits in knockout mouse neurons would reveal functional conservation across species.

  • Expression pattern comparison: Determining whether the cell-type specific expression and function of LHFPL4 is conserved across species would provide insights into the evolution of inhibitory circuit specialization.

  • Paralog comparison: LHFPL4 belongs to a gene family that includes members implicated in deafness and other conditions . Comparative studies of LHFPL family members could reveal specialization of function across paralogs.

What are the critical quality control parameters for recombinant LHFPL4 protein?

When working with recombinant bovine LHFPL4, several quality control steps are essential:

  • Protein integrity verification:

    • SDS-PAGE to confirm expected molecular weight (~27 kDa) and purity

    • Western blotting with specific antibodies to confirm identity

    • Mass spectrometry for precise molecular weight determination and sequence confirmation

  • Functional validation:

    • Binding assays to confirm interaction with known partners (GABA-A receptor subunits, gephyrin)

    • Circular dichroism to assess proper protein folding

    • Thermal shift assays to evaluate protein stability

  • Post-translational modification analysis:

    • Phosphorylation state assessment, as LHFPL4 may be regulated by phosphorylation

    • Glycosylation analysis if relevant to protein function

  • Aggregation assessment:

    • Size-exclusion chromatography to verify monodispersity

    • Dynamic light scattering to detect potential protein aggregation

How can researchers address experimental variability in LHFPL4 studies?

The search results indicated considerable variability in experimental outcomes in LHFPL4 research, particularly in electrophysiological recordings . To address this:

  • Cell-type identification:

    • Use cell-type specific markers (e.g., CAMKIIα for excitatory neurons, GAD6 for inhibitory neurons)

    • Consider cell-type specific genetic labeling approaches

    • Factor cell-type into analysis of experimental outcomes

  • Statistical approaches:

    • Increase sample sizes to accommodate natural variability

    • Consider hierarchical or nested statistical designs that account for variability between cultures or animals

    • Use appropriate statistical tests for non-normally distributed data

  • Standardized protocols:

    • Develop consistent culture conditions for in vitro experiments

    • Standardize the age, sex, and genetic background of experimental animals

    • Implement rigorous blinding procedures for analysis

  • Complementary approaches:

    • Validate findings using multiple independent techniques

    • Combine population-level measurements with single-cell analyses

How might novel technologies advance our understanding of LHFPL4 function?

Several emerging technologies hold promise for deeper insights into LHFPL4 biology:

  • Cryo-electron microscopy: Determining the structure of LHFPL4 alone or in complex with GABA-A receptors could reveal the molecular basis of their interaction and inform structure-based drug design.

  • Single-molecule imaging: Techniques like single-particle tracking could reveal the dynamics of LHFPL4 and GABA-A receptor interaction in living neurons, providing insights into the temporal aspects of receptor stabilization.

  • Optogenetic and chemogenetic approaches: These tools could enable temporally precise manipulation of LHFPL4 function to dissect its acute versus developmental roles in inhibitory synapse maintenance.

  • CRISPR-based screening: Genome-wide or targeted screens could identify additional genes that interact with LHFPL4 in regulating inhibitory synapse function.

  • Patient-derived iPSCs: Neurons derived from patient iPSCs carrying mutations in inhibitory synapse genes could be used to study how LHFPL4 function intersects with human disease mechanisms.

What are the therapeutic implications of targeting LHFPL4 pathways?

Given LHFPL4's specialized role in inhibitory synapse function, modulating its activity or expression could have therapeutic potential:

  • Enhancing LHFPL4 function: In conditions characterized by reduced inhibitory control (epilepsy, some forms of autism), strategies to enhance LHFPL4 expression or function might strengthen inhibitory transmission.

  • Cell-type specific approaches: The selective dependence of excitatory neurons on LHFPL4 for inhibitory synapse maintenance offers an opportunity for cell-type specific therapeutic strategies that wouldn't affect interneuron function.

  • Targeting protein-protein interactions: Small molecules that enhance LHFPL4's interaction with GABA-A receptors could potentially stabilize inhibitory synapses and enhance GABAergic transmission.

  • Gene therapy approaches: For conditions involving LHFPL4 mutations, gene replacement strategies could potentially restore normal inhibitory synapse function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.