Recombinant Bovine Low-density lipoprotein receptor (LDLR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
LDLR; Low-density lipoprotein receptor; LDL receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SKLHSISSIDVNGGNRKTVLEDKKKLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDI SLMAENLLSPEDIVLFHNLTQPRGVNWCERTALRNGGCQYLCLPAPQINPRSPKFTCACP DGMLLAKDMRSCLTESESAVTTRGPSTVSSTAVGPKRTASPELTTAESVTMSQQGQGDVA SQADTERPGSVGALYIVLPIALLILLAFGTFLLWKNWRLKSINSINFDNPVYQKTTEDEV HICRSQDGYTYPSRQMVSLEDDVA
Uniprot No.

Target Background

Function
The recombinant bovine Low-density lipoprotein receptor (LDLR) binds LDL, the primary cholesterol-carrying lipoprotein in plasma, and facilitates its cellular uptake via receptor-mediated endocytosis. Internalization requires the clustering of receptor-ligand complexes into clathrin-coated pits.
Gene References Into Functions
  1. Nonesterified fatty acids significantly inhibit the expression of ApoB100, ApoE, MTP, and LDLR, consequently reducing VLDL synthesis and assembly while inducing triglyceride accumulation in bovine hepatocytes. PMID: 24377799
Database Links

KEGG: bta:281276

STRING: 9913.ENSBTAP00000016342

UniGene: Bt.3562

Protein Families
LDLR family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane, clathrin-coated pit. Golgi apparatus. Early endosome. Late endosome. Lysosome.

Q&A

What is the basic structure of bovine LDLR and how does it compare to human LDLR?

Bovine LDLR is a cell surface glycoprotein that mediates endocytosis of macromolecular ligands, particularly low-density lipoproteins. The receptor has a calculated molecular weight of approximately 95 kDa, but the observed molecular weight in experimental conditions typically ranges between 140-160 kDa due to post-translational modifications . The bovine LDLR gene encodes a single-copy gene containing introns, as demonstrated by Southern blot analysis with 32P-labeled pLDLR-1 .

Structurally, bovine LDLR shares significant homology with human LDLR, which spans from Ala22 to Arg788 . The cross-hybridization of bovine LDLR cDNA (pLDLR-1) to human mRNA in epidermoid carcinoma A-431 cells confirms this interspecies conservation . Both proteins function through clustering into clathrin-coated pits, which promotes receptor-mediated endocytosis of bound ligands .

How is bovine LDLR gene expression regulated at the transcriptional level?

Bovine LDLR expression demonstrates tissue-specific regulation and feedback control mechanisms. The mRNA for bovine LDLR is approximately 5.5 kb in size and exhibits differential expression patterns, being approximately 9-fold more abundant in bovine adrenal gland compared to bovine liver . This suggests tissue-specific transcriptional control mechanisms.

Similar to human LDLR, bovine LDLR expression is subject to feedback regulation by sterols. Research has demonstrated that when sterols are added to culture medium, LDLR mRNA levels are markedly reduced . This sterol-mediated suppression explains the previously observed feedback regulation of LDLR protein and indicates conservation of regulatory mechanisms across species. This feedback system allows cells to modulate cholesterol uptake according to intracellular sterol levels, maintaining lipid homeostasis.

What are the established methods for cloning bovine LDLR cDNA?

The seminal approach for cloning bovine LDLR cDNA involves constructing a cDNA library from tissues with high LDLR expression, particularly the adrenal gland. The validated protocol involves:

  • Isolation of poly(A)+ RNA from bovine adrenal tissue

  • Enrichment of receptor mRNA through immunopurification of polysomes

  • Construction of a cDNA library using the Okayama-Berg method

  • Design of hybridization probes based on known amino acid sequences of LDLR fragments

  • Screening the library with synthetic oligonucleotides encoding amino acid sequences from cyanogen bromide fragments of the receptor

Using this approach, researchers successfully isolated a recombinant plasmid designated pLDLR-1, containing a 2.8-kilobase insert that corresponded to the known amino acid sequence of a 36-residue cyanogen bromide fragment of the receptor . This methodology establishes a foundation for generating recombinant bovine LDLR for further studies.

What protein expression systems are optimal for producing functional recombinant bovine LDLR?

While the search results don't specifically address expression systems for bovine LDLR, the approaches used for human LDLR can be adapted. Based on available information, mammalian expression systems are preferred for producing functional LDLR due to the requirement for proper post-translational modifications, particularly glycosylation.

Recombinant LDLR often incorporates a C-terminal tag, such as a 6-His tag, to facilitate purification . The expression construct should include the sequence encoding the mature protein (without the signal peptide) if secretion is desired, or the full-length sequence for membrane-bound expression. CHO or HEK293 cells are commonly used for mammalian expression, while insect cells (Sf9 or Hi5) with baculovirus systems represent an alternative that often yields higher protein amounts with proper folding.

For functional studies, it's critical to verify that the recombinant protein retains LDL-binding capability through binding assays using labeled LDL particles.

What are the most effective purification strategies for recombinant bovine LDLR?

Two effective purification strategies for bovine LDLR have been documented:

Method I: Chromatographic Purification

  • Preparation of membrane proteins from bovine tissue (typically liver)

  • Resuspension in appropriate buffer (10 mM Tris-HCl, pH 8/1 mM CaCl₂/0.15 M NaCl/1 mM PMSF)

  • Solubilization with Triton X-100

  • Affinity chromatography using maleyl-BSA columns

  • Further purification via hydroxylapatite chromatography (Ultrogel-HA column) with a phosphate buffer gradient (25-350 mM) containing octyl glucoside

  • Final purification through non-reducing SDS-PAGE and electroelution

Method II: Immunoaffinity Purification

  • Initial purification through maleyl-BSA affinity chromatography

  • Immunoaffinity purification using monoclonal antibodies specific to the receptor

  • Elution under mild conditions to preserve functional activity

These methods have successfully yielded purified bovine LDLR with retained binding activity. The choice between methods depends on the required purity, quantity, and preservation of functional properties.

How can researchers verify the functional activity of purified recombinant bovine LDLR?

Verification of functional activity for purified recombinant bovine LDLR should address both structural integrity and ligand-binding capability:

  • Ligand Binding Assays: Assessment of binding kinetics using 125I-labeled acetyl LDL or LDL. Published data indicate that purified bovine acetyl LDL receptor binds 125I-acetyl LDL with an apparent dissociation constant of 0.5 μg/ml (0.8 nM) .

  • Competitive Inhibition Studies: Evaluate specificity by testing inhibition with known LDLR ligands. The binding is characteristically inhibited by maleyl-BSA, fucoidan, polyvinylsulfate, and other negatively charged macromolecules .

  • Receptor Clustering Analysis: Since functional LDLR must cluster into clathrin-coated pits for internalization , fluorescence microscopy with labeled receptor can verify this capability.

  • Western Blotting: Confirm structural integrity using specific antibodies. Expected molecular weight for bovine LDLR is 140-160 kDa under non-reducing conditions .

  • Endocytosis Assays: In cell-based systems, verify internalization of labeled ligands mediated by the recombinant receptor.

A comprehensive verification approach combines multiple methods to ensure both structural and functional integrity of the purified protein.

What immunoassay approaches are available for quantification of bovine LDLR?

Several immunoassay approaches are available for bovine LDLR quantification:

  • Sandwich ELISA: Commercial kits specifically designed for bovine LDLR are available with high sensitivity for serum, plasma, and tissue homogenates. These assays typically use specific antibodies to capture the LDLR and then detect it with labeled secondary antibodies .

  • Western Blotting: Using specific antibodies such as rabbit recombinant LDLR antibody (82724-1-RR) at a dilution of 1:2000-1:10000. This method can detect LDLR in various sample types including tissue homogenates and cell lysates .

  • Immunohistochemistry (IHC): For tissue localization studies, LDLR antibodies can be used at a dilution of 1:200-1:800, with suggested antigen retrieval using TE buffer pH 9.0 or citrate buffer pH 6.0 .

  • Immunofluorescence/Immunocytochemistry (IF/ICC): For cellular localization, LDLR antibodies can be used at a dilution of 1:50-1:500 .

When selecting an approach, researchers should consider the sample type, required sensitivity, and whether quantitative or qualitative data is needed. For quantitative analysis in complex biological samples, sandwich ELISA typically offers the best combination of specificity and sensitivity.

How can researchers distinguish between endogenous and recombinant bovine LDLR in experimental systems?

Distinguishing between endogenous and recombinant bovine LDLR requires strategic experimental design:

  • Tag-based Detection: Incorporate epitope tags (His, FLAG, HA) into the recombinant construct. The reported use of C-terminal 6-His tags in recombinant LDLR constructs facilitates this approach .

  • Antibody Selection: Use antibodies that specifically recognize the tag portion of the recombinant protein or antibodies that recognize species-specific epitopes if the recombinant protein is expressed in cells from a different species.

  • Size Differences: Exploit size differences between endogenous and recombinant proteins due to tags or truncations. Western blot analysis can reveal these differences, with native bovine LDLR typically appearing at 140-160 kDa .

  • Expression Level Analysis: Compare expression levels between transfected and control cells, as recombinant proteins are often expressed at significantly higher levels than endogenous proteins.

  • Genetic Approaches: Use LDLR-knockout cell lines for expression studies to eliminate endogenous background.

  • Domain-specific Antibodies: If the recombinant protein contains only specific domains of LDLR, use antibodies targeting those domains exclusively.

A combination of these approaches provides the most reliable differentiation between endogenous and recombinant proteins in experimental systems.

How does bovine LDLR compare functionally with the acetyl LDL receptor identified in bovine tissues?

The bovine LDLR and the bovine acetyl LDL receptor represent distinct but related receptor types with notable differences:

  • Structural Differences:

    • The acetyl LDL receptor is a 220-kDa protein formed from a trimer of 77-kDa glycoprotein subunits containing asparagine-linked carbohydrate chains

    • In contrast, bovine LDLR has an observed molecular weight of 140-160 kDa

  • Ligand Specificity:

    • The acetyl LDL receptor recognizes a broad range of negatively charged macromolecules including acetylated LDL, maleyl-BSA, fucoidan, and polyvinylsulfate

    • Bovine LDLR primarily binds native LDL and transports it into cells by endocytosis

  • Expression Pattern:

    • The acetyl LDL receptor is primarily expressed on macrophages and some endothelial cells

    • LDLR shows broader expression but with tissue-specific variation, being 9-fold more abundant in bovine adrenal than in bovine liver

  • Functional Role:

    • The acetyl LDL receptor mediates macrophage-foam cell formation, relevant to atherosclerosis pathogenesis

    • LDLR functions primarily in cholesterol homeostasis through receptor-mediated endocytosis of LDL particles

These differences highlight the specialized roles of these receptor types in lipid metabolism and pathophysiological processes, despite their shared capability to bind modified lipoproteins.

What structural domains of bovine LDLR are critical for maintaining proper binding and endocytosis functions?

While the search results don't provide specific information about bovine LDLR domains, functional studies of LDLR across species indicate several critical structural elements:

  • Ligand-binding Domains: The N-terminal region contains cysteine-rich repeats that form the LDL-binding site. These domains must maintain their structural integrity for proper ligand recognition.

  • NPXY Motif: The cytoplasmic domain contains an NPXY motif that interacts with adaptor proteins such as DAB2 (via its PID domain) . This interaction is essential for receptor clustering in clathrin-coated pits and subsequent endocytosis.

  • Clathrin-coated Pit Localization Signals: The cytoplasmic domain of LDLR contains signals necessary for the receptor to cluster in coated pits, which is a prerequisite for rapid endocytosis of bound LDL .

  • Glycosylation Sites: The presence of asparagine-linked carbohydrate chains, similar to those observed in the acetyl LDL receptor , suggests their importance for proper folding, stability, or trafficking of the receptor.

Mutation or modification of these domains can impair receptor function, leading to disrupted cholesterol homeostasis. Recombinant bovine LDLR constructs should preserve these domains to maintain proper functionality in experimental systems.

How can recombinant bovine LDLR be utilized in studying receptor-mediated endocytosis mechanisms?

Recombinant bovine LDLR serves as an excellent model system for studying receptor-mediated endocytosis due to its well-characterized internalization pathway:

  • Trafficking Studies: Fluorescently tagged recombinant bovine LDLR can be used to monitor receptor movement from the cell surface through endocytic compartments. This approach enables real-time visualization of receptor clustering in clathrin-coated pits, a critical step for internalization .

  • Structure-Function Analysis: By generating recombinant bovine LDLR variants with mutations in key domains (e.g., the NPXY motif that interacts with DAB2 ), researchers can dissect the molecular requirements for different stages of endocytosis.

  • Interactome Mapping: Recombinant bovine LDLR with affinity tags facilitates purification of receptor complexes to identify novel interaction partners involved in endocytosis using mass spectrometry.

  • Comparative Endocytosis Kinetics: The documented binding parameters of bovine receptors (e.g., Kd of 0.8 nM for the acetyl LDL receptor ) provide a foundation for comparative studies of endocytosis kinetics across different cell types or receptor variants.

  • Receptor Recycling Analysis: Pulse-chase experiments with labeled recombinant bovine LDLR can reveal the dynamics of receptor recycling to the plasma membrane following endocytosis.

These approaches contribute to mechanistic understanding of receptor-mediated endocytosis beyond LDLR itself, informing broader principles of membrane trafficking.

What experimental strategies can address the feedback regulation of bovine LDLR by sterols?

The documented sterol-mediated suppression of LDLR mRNA provides a foundation for investigating regulatory mechanisms through several experimental strategies:

  • Reporter Gene Assays: Construct promoter-reporter systems containing the bovine LDLR promoter region driving expression of luciferase or fluorescent proteins. These constructs can quantitatively assess promoter activity in response to various sterol treatments.

  • CRISPR/Cas9 Editing: Generate targeted modifications in sterol-responsive elements within the bovine LDLR promoter to identify critical regulatory sequences mediating feedback inhibition.

  • ChIP-seq Analysis: Identify transcription factors binding to the LDLR promoter under normal versus sterol-rich conditions, focusing on known regulators such as SREBP (Sterol Regulatory Element Binding Protein).

  • RNA Stability Assays: Determine whether sterols affect LDLR mRNA half-life in addition to transcriptional regulation, using actinomycin D to block transcription followed by time-course RT-qPCR.

  • Comparative Analysis Across Tissues: Given the 9-fold higher expression in adrenal compared to liver , investigate tissue-specific differences in feedback regulation mechanisms through ex vivo tissue culture systems exposed to sterols.

These approaches can reveal molecular mechanisms underlying the observed 9-fold difference in LDLR expression between bovine adrenal and liver tissues, potentially identifying tissue-specific regulatory factors controlling LDLR expression.

What factors most commonly affect the stability and activity of purified recombinant bovine LDLR?

Several factors can impact the stability and activity of purified recombinant bovine LDLR:

  • Buffer Composition: The search results indicate that bovine LDLR stability is enhanced in PBS buffer containing carrier proteins. For recombinant proteins, adding bovine serum albumin (BSA) enhances protein stability and increases shelf-life .

  • Freeze-Thaw Cycles: Repeated freeze-thaw cycles should be avoided, as indicated in storage recommendations. Use of a manual defrost freezer is recommended for long-term storage .

  • Detergent Selection: For membrane-associated forms, the choice of detergent is critical. Octyl glucoside (40 mM) has been successfully used in purification protocols .

  • Glycosylation Status: As bovine LDLR contains asparagine-linked carbohydrate chains similar to the acetyl LDL receptor , proper glycosylation is likely essential for stability and activity. Expression systems should be selected to ensure appropriate post-translational modifications.

  • Concentration Effects: Dilute protein concentrations can lead to adsorption losses. Storing the recombinant protein at higher concentrations (e.g., 100 μg/mL as recommended for reconstitution ) can mitigate this issue.

  • Protease Contamination: Inclusion of protease inhibitors (e.g., PMSF at 1 mM) in purification and storage buffers can prevent degradation .

Researchers should monitor protein stability and activity through regular functional assays, particularly when modifying storage or handling conditions.

How can researchers overcome challenges in detecting low-abundance bovine LDLR in experimental samples?

Detection of low-abundance bovine LDLR presents challenges that can be addressed through several methodological approaches:

  • Sample Enrichment Techniques:

    • Immunoprecipitation using specific antibodies before analysis

    • Subcellular fractionation to concentrate membrane proteins

    • Polysome immunopurification for mRNA studies, as used in the original cloning work

  • Signal Amplification Strategies:

    • For Western blotting: Use enhanced chemiluminescence (ECL) substrates with high sensitivity

    • For immunohistochemistry: Employ tyramide signal amplification (TSA) systems

    • For ELISA: Utilize biotin-streptavidin amplification systems

  • Optimized Antibody Selection and Usage:

    • Use antibodies with validated high affinity for bovine LDLR

    • Optimize antibody dilutions for maximum signal-to-noise ratio (e.g., 1:2000-1:10000 for Western blot, 1:200-1:800 for IHC)

    • Consider recombinant antibodies for greater consistency

  • Improved Sample Preparation:

    • Optimize antigen retrieval for fixed samples (e.g., TE buffer pH 9.0 or citrate buffer pH 6.0)

    • For cell studies, upregulate LDLR expression by pre-incubating in lipoprotein-depleted media

  • Sensitive Detection Systems:

    • Use cooled CCD camera systems for chemiluminescence detection

    • Employ confocal microscopy with photomultiplier tubes for immunofluorescence

    • Consider digital PCR for transcript detection at very low abundance

By combining these approaches, researchers can significantly improve detection sensitivity for bovine LDLR in experimental systems where expression levels are limiting.

What are the most promising applications of recombinant bovine LDLR in comparative receptor biology research?

Recombinant bovine LDLR offers several promising applications in comparative receptor biology:

  • Evolutionary Conservation Studies: The cross-hybridization of bovine LDLR cDNA to human mRNA indicates evolutionary conservation, making bovine LDLR valuable for studying functional conservation across species. Comparative studies could reveal which receptor domains and functions have been preserved through evolution.

  • Species-Specific Regulatory Mechanisms: The marked tissue-specific expression differences (9-fold higher in adrenal than liver) provide an opportunity to investigate species-specific transcriptional control mechanisms that may differ from those in human or mouse models.

  • Receptor Family Comparative Analysis: As the founding member of the LDL receptor family , bovine LDLR serves as a reference point for comparative studies with other family members. Chimeric constructs combining domains from different receptors could elucidate domain-specific functions.

  • Structure-Function Relationships: The availability of recombinant bovine LDLR facilitates comparative structural studies with human LDLR, potentially revealing species-specific adaptations in ligand binding or internalization mechanisms.

  • Lipid Metabolism Variations: Bovine models could provide insights into species-specific adaptations in lipid metabolism pathways relevant to comparative physiology and evolutionary biology.

These applications extend beyond basic receptor biology to broader questions in evolutionary biochemistry and comparative physiology.

What technological advances are needed to enhance recombinant bovine LDLR research?

Several technological advances would significantly enhance recombinant bovine LDLR research:

  • Improved Expression Systems: Development of expression systems that more faithfully reproduce the native glycosylation patterns and post-translational modifications of bovine LDLR without requiring mammalian cell culture.

  • Cryo-EM Structural Analysis: High-resolution structural determination of bovine LDLR in various conformational states and in complex with ligands would provide mechanistic insights into receptor function.

  • In Vivo Imaging Capabilities: Development of bovine-specific nanobodies or small molecule ligands that enable real-time imaging of LDLR trafficking in live bovine tissues or primary cell cultures.

  • Single-Molecule Analysis Techniques: Methods to study individual receptor molecules in native membrane environments would advance understanding of clustering behaviors critical for endocytosis.

  • Tissue-Specific Knockout Models: Creation of conditional, tissue-specific LDLR knockout cattle models using CRISPR/Cas9 technology would enable in vivo functional studies.

  • High-Throughput Interaction Screening: Development of techniques to rapidly screen for novel LDLR interaction partners across different bovine tissues could reveal tissue-specific regulatory mechanisms.

  • Quantitative Proteomics Approaches: Advanced methods to accurately quantify LDLR protein levels and modification states in complex tissue samples would enhance understanding of post-transcriptional regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.