Recombinant Bovine Lysophosphatidic acid receptor 1 (LPAR1)

Shipped with Ice Packs
In Stock

Description

Discovery and Classification

Lysophosphatidic acid receptor 1 was the first lysophospholipid receptor identified and remains the most extensively studied among the six known LPA receptors (LPA1-6). Originally designated as "ventricular zone gene-1" due to its enriched expression in the embryonic neuroproliferative layer of the cerebral cortex, this receptor's identification led to the deorphanization of other putative receptor genes based on sequence homology, particularly "endothelial differentiation gene" (EDG) members that include both LPA and sphingosine 1-phosphate receptors .

Molecular Structure and Signaling Pathways

LPAR1 functions as a G protein-coupled receptor (GPCR) with seven transmembrane domains. In humans, the LPAR1 gene is located on chromosome locus 9q31.3 and encodes a 41 kDa protein containing 364 amino acids. The mouse ortholog (Lpar1) is located on chromosome locus 4, 32.2 cM and encompasses five exons with a conserved intron interrupting the sixth transmembrane domain .

LPAR1 exhibits remarkable signaling versatility, coupling with three types of G proteins: Gi/o, Gq/11, and G12/13. These interactions initiate downstream signaling cascades through phospholipase C, MAPK, Akt, and Rho. Receptor activation modulates numerous cellular responses including:

  • Cell proliferation and survival

  • Cell-cell contact through serum-response element activation

  • Cell migration and cytoskeletal reorganization

  • Calcium mobilization

  • Adenylyl cyclase inhibition

Expression Patterns in Bovine Tissues

Analysis of bovine endometrial tissue has revealed consistent LPAR1 expression during various reproductive stages. Specifically, LPAR1 mRNA has been detected on days 2-4, 8-10, and 17-19 of both the estrous cycle and pregnancy. This expression manifests as a distinctive 150 base pair band when analyzed through molecular techniques .

Functional Correlations in Bovine Reproductive Physiology

A particularly notable finding regarding bovine LPAR1 is its correlation with prostaglandin synthesis enzymes in the endometrium. Research indicates that LPAR1 expression positively correlates with prostaglandin E2 synthase (PGES) expression while showing negative correlation with prostaglandin F synthase (PGFS) expression . This relationship suggests a regulatory role for LPAR1 in prostaglandin-mediated functions in bovine reproductive physiology, potentially influencing processes such as implantation, pregnancy maintenance, or parturition.

Table 1: Key Characteristics of Bovine LPAR1 Compared to Other Species

CharacteristicBovine LPAR1Human LPAR1Mouse LPAR1
Expression in reproductive tissuesEndometrium during estrous cycle and pregnancyUterus, placentaUterus, placenta
Correlation with other signaling moleculesPositive correlation with PGES, negative with PGFSNot specified in search resultsNot specified in search results
Size of mRNA transcript (detected band)150 bpNot specified in search resultsNot specified in search results
G protein couplingPresumed Gi/o, Gq/11, G12/13 (based on homology)Gi/o, Gq/11, G12/13Gi/o, Gq/11, G12/13

Potential Expression Systems

While the search results do not specifically describe recombinant expression systems for bovine LPAR1, approaches similar to those employed for other species could be applied. Based on strategies used for mouse LPAR1, several expression systems appear promising:

  1. Mammalian cell lines (HEK293, CHO cells)

  2. Insect cell expression systems (Sf9, Hi5 cells with baculovirus)

  3. Yeast expression systems (Pichia pastoris, Saccharomyces cerevisiae)

The selection of an appropriate expression system would depend on specific requirements for protein folding, post-translational modifications, and intended research applications.

Fusion Protein Approaches

The development of the Lpar1-EGFP knock-in mouse model demonstrates a viable strategy for creating fusion proteins with LPAR1 that maintain functionality. This approach involved in-frame fusion of enhanced green fluorescent protein (EGFP) to the 4th exon of Lpar1, suggesting that C-terminal tagging of LPAR1 is compatible with protein function .

For recombinant bovine LPAR1, similar fusion protein strategies could be employed to facilitate:

  • Visualization of receptor expression in various cell types

  • Monitoring of receptor trafficking and localization

  • Protein purification via affinity tags

  • Structure-function studies

Applications in Research and Biotechnology

Recombinant bovine LPAR1 would enable numerous research applications:

  1. Screening platforms for agonist/antagonist discovery

  2. Investigation of bovine-specific signaling mechanisms

  3. Comparative analysis with human LPAR1 for translational research

  4. Studies of reproductive physiology and pathology in cattle

Table 2: Potential Research Applications of Recombinant Bovine LPAR1

Research AreaApplicationPotential Impact
Reproductive biologyStudy of LPA signaling in bovine fertilityImproved reproductive management in cattle
Structural biologyDetermination of bovine LPAR1 crystal structureEnhanced understanding of species-specific ligand binding
PharmacologyScreening for bovine-specific LPAR1 modulatorsDevelopment of veterinary therapeutics
Comparative biologyAnalysis of species differences in LPAR1 signalingBetter translation between animal models and human applications
Cellular signalingInvestigation of bovine-specific LPA-mediated pathwaysUnderstanding of tissue-specific responses in cattle

Gene Cloning and Vector Design

The generation of recombinant bovine LPAR1 would require similar methodologies to those employed for the Lpar1-EGFP knock-in model described in the search results. This would involve:

  1. Isolation and amplification of bovine LPAR1 genomic DNA fragments

  2. Design of expression constructs with appropriate regulatory elements

  3. In-frame fusion with detection or purification tags

  4. Selection of optimal vector systems for the chosen expression host

Validation Approaches

Functional validation of recombinant bovine LPAR1 could be assessed through:

  1. Ligand binding assays

  2. G protein coupling studies

  3. Downstream signaling activation analysis

  4. Comparison with native bovine LPAR1 expression patterns

The Lpar1-EGFP knock-in model demonstrated that homozygous animals appeared phenotypically indistinguishable from littermate controls, showed normal Mendelian ratios, and were fertile . Similar validation approaches could confirm the functionality of recombinant bovine LPAR1 constructs.

Agricultural and Veterinary Applications

Given the expression of LPAR1 in bovine endometrium and its correlation with prostaglandin-synthesizing enzymes, recombinant bovine LPAR1 could have significant applications in agricultural and veterinary medicine, particularly in areas related to bovine reproduction .

Comparative Studies and Translational Potential

Recombinant bovine LPAR1 would facilitate comparative studies with LPAR1 from other species, including humans and mice. Such comparisons could provide insights into species-specific differences in LPA signaling and receptor function, potentially informing both basic science and translational research.

Outstanding Questions

Several important questions remain regarding bovine LPAR1:

  1. What is the complete expression profile across different bovine tissues and developmental stages?

  2. How does bovine LPAR1 signaling differ from that of other species?

  3. What role does LPAR1 play in bovine-specific physiological processes?

  4. Can species-specific modulators of bovine LPAR1 be developed for veterinary applications?

Recombinant expression systems for bovine LPAR1 would provide essential tools to address these questions and advance our understanding of this important signaling receptor in bovine physiology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
LPAR1; EDG2; LPA1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2; Rec1.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAAAFTSSPVVSQPQFTAMNEQQCFSNESIAFFYNRSGKYLATEWNTVTKLVMGLGITVC IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTVSVANLLAIAIERHITVFRMQLHARMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENTSGPTEGSDRSASSLNHTILAGVHSND HSVV
Uniprot No.

Target Background

Function
Lysophosphatidic acid receptor 1 (LPAR1) is a receptor for lysophosphatidic acid (LPA). It plays a crucial role in actin cytoskeleton reorganization, cell migration, differentiation, and proliferation, contributing to responses to tissue injury and infection. LPAR1 activates downstream signaling cascades through Gi/Go, G12/G13, and Gq heteromeric G proteins. This signaling inhibits adenylyl cyclase, reducing cAMP levels, and increases cytoplasmic Ca2+. It activates RALA, leading to phospholipase C (PLC) activation and inositol 1,4,5-trisphosphate formation. Downstream MAP kinase activation is also mediated. LPAR1 regulates cell shape, promotes Rho-dependent actin cytoskeleton reorganization and neurite retraction in neurons, and promotes actin stress fiber formation. It promotes lamellipodia formation via RAC1 activation in migrating cells. As an LPA receptor, LPAR1 is involved in chemotaxis and cell migration, including responses to injury. It contributes to inflammation triggered by bacterial lipopolysaccharide (LPS) via interaction with CD14. LPAR1 promotes LPA-induced cell proliferation, and is essential for normal skeletal and brain development. It is also required for the proliferation, survival, and maturation of newly formed neurons in the adult dentate gyrus and is involved in pain perception and neuropathic pain initiation.
Gene References Into Functions
  1. Lower expression in endometrial epithelial cells compared to stromal cells. PMID: 23522079
  2. Lysophosphatidic acid stimulates PGE2 production, cell viability, and intracellular calcium mobilization in cultured endometrial stromal cells via Ki16425-sensitive LPA1 receptors. PMID: 19491366
Database Links

KEGG: bta:281136

STRING: 9913.ENSBTAP00000012721

UniGene: Bt.123

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.

Q&A

What is the genomic and protein structure of bovine LPAR1?

Bovine LPAR1, like its human counterpart, is a G protein-coupled receptor with seven transmembrane domains. The LPAR1 gene encodes a protein of approximately 41 kDa containing 364 amino acids with characteristic 7-TM domains . While the complete crystal structure of bovine LPAR1 has not been fully elucidated, constraint modeling based on other GPCRs has facilitated structural predictions, particularly in the second extracellular loop .

Computer-modeled mutagenesis studies have identified three key residues in LPAR1-3 signaling: R3.28A and K7.36A (important for efficacy and potency of LPA), and Q3.29A (decreases ligand interaction and activation) . The bovine LPAR1 gene organization includes five exons with a conserved intron interrupting the sixth transmembrane domain, a feature shared among LPAR1-3 .

How does bovine LPAR1 compare to LPAR1 from other species in terms of sequence homology and functional conservation?

Bovine LPAR1 shares significant sequence homology with LPAR1 from other mammalian species. While the search results don't provide exact homology percentages for bovine LPAR1 specifically, research indicates that LPAR1 shares approximately 50-60% amino acid sequence identity with LPAR2 and LPAR3 within the same species .

The functional conservation of LPAR1 across species is demonstrated by its consistent coupling with three types of G proteins (Gi/o, Gq/11, and G12/13) across mammalian systems, initiating downstream signaling cascades through phospholipase C, MAPK, Akt, and Rho . These conserved signaling pathways regulate fundamental cellular responses including cell proliferation, survival, cell-cell contact, migration, cytoskeletal changes, Ca²⁺ mobilization, and adenylyl cyclase inhibition .

What are the tissue distribution patterns of LPAR1 in bovine systems?

While the search results don't specifically detail the complete tissue distribution of LPAR1 in bovine systems, they do confirm the expression of LPAR1 in bovine reproductive tissues, particularly in oocytes and cumulus cells . Based on comparative mammalian data, LPAR1 likely follows a similar wide distribution pattern as observed in mice and humans.

In mammalian systems generally, LPAR1 expression has been documented in brain, uterus, testis, lung, small intestine, heart, stomach, kidney, spleen, thymus, placenta, and skeletal muscle . Given the conservation of LPAR1 function across species, bovine LPAR1 likely shares this broad distribution pattern, with potentially specialized expression in reproductive tissues that reflects its role in bovine reproduction.

What are the most effective methods for isolating and purifying recombinant bovine LPAR1?

For isolating and purifying recombinant bovine LPAR1, researchers should employ a multistep approach beginning with gene cloning and expression system selection. The bovine LPAR1 gene sequence should be PCR-amplified from bovine tissue cDNA (preferably from tissues with high LPAR1 expression such as brain or reproductive tissues) and inserted into an appropriate expression vector containing affinity tags (His-tag or FLAG-tag) for purification.

For membrane protein expression, mammalian expression systems (HEK293 or CHO cells) typically yield properly folded and post-translationally modified LPAR1. Alternatively, baculovirus-insect cell systems can provide higher protein yields while maintaining proper folding. Following expression, membrane fractionation through ultracentrifugation is essential, followed by solubilization using mild detergents (DDM, LMNG, or GDN) that maintain protein structure and function.

Affinity chromatography using the incorporated tags, followed by size exclusion chromatography for further purification, yields functional receptor protein. Throughout purification, it's crucial to validate LPAR1 functionality through ligand binding assays using radiolabeled or fluorescent LPA derivatives, as membrane protein purification can often compromise receptor activity.

What are the reliable methods for detecting LPAR1 expression in bovine tissues and cells?

Multiple complementary approaches should be employed for reliable detection of LPAR1 expression in bovine tissues and cells:

  • Quantitative RT-PCR: This technique has been successfully used to detect LPAR1-4 transcripts in bovine oocytes and cumulus cells following in vitro maturation . Primers should be designed specifically for bovine LPAR1 sequences to avoid cross-reactivity with other LPA receptors.

  • Western blotting: While the search results note that visualization of LPAR1 has been "hampered by lack of validated antibodies" , researchers should test commercially available antibodies raised against conserved regions of mammalian LPAR1. Cross-reactivity testing with recombinant bovine LPAR1 protein is essential for validation.

  • Immunohistochemistry/Immunocytochemistry: For tissue distribution studies, validated antibodies can be used for spatial localization of LPAR1 in bovine tissues, though proper controls must be included given the antibody limitations mentioned.

  • Functional assays: Since LPAR1 couples to G proteins that activate multiple signaling pathways, functional detection can include measuring Ca²⁺ mobilization, ERK1/2 phosphorylation, or cAMP reduction in response to LPA stimulation, followed by validation with specific LPAR1 antagonists.

How can researchers develop and validate effective antibodies against bovine LPAR1?

Developing effective antibodies against bovine LPAR1 requires systematic approaches to overcome the challenges noted in the literature regarding LPAR1 antibody validation . Researchers should:

  • Design immunogenic peptides from extracellular domains of bovine LPAR1, avoiding highly conserved transmembrane regions that may cross-react with other GPCRs. The N-terminal domain and extracellular loops offer the best targets for specificity.

  • Produce both polyclonal and monoclonal antibodies, as each offers different advantages: polyclonal antibodies provide robust detection while monoclonals offer greater specificity.

  • Implement rigorous validation using multiple controls:

    • Recombinant bovine LPAR1 as positive control

    • Tissues from LPAR1 knockout models (if available) as negative controls

    • Pre-absorption controls with immunizing peptides

    • Western blotting to confirm specificity (single band of expected size)

    • Comparative detection in tissues known to express high versus low LPAR1 levels

  • Validate functionality through techniques like immunoprecipitation followed by mass spectrometry to confirm target identity, and immunostaining patterns consistent with known LPAR1 distribution in bovine tissues.

What signaling pathways are activated by bovine LPAR1 and how do they differ from other LPA receptors?

Bovine LPAR1, similar to its counterparts in other species, couples with three types of G proteins: Gi/o, Gq/11, and G12/13 . These G protein interactions trigger distinct downstream signaling cascades:

  • Through Gi/o coupling: LPAR1 activation leads to inhibition of adenylyl cyclase, reducing cAMP levels. It also activates the PI3K/Akt pathway promoting cell survival, as well as MAPK pathways driving cell proliferation .

  • Through Gq/11 coupling: LPAR1 stimulates phospholipase C activity, leading to IP3 formation and subsequent Ca²⁺ mobilization from intracellular stores .

  • Through G12/13 coupling: LPAR1 activates Rho GTPases, triggering cytoskeletal rearrangements that influence cell morphology and migration .

What distinguishes LPAR1 from other LPA receptors (e.g., LPAR2-6) is its specific combination of coupled G proteins and downstream effects. For instance, while LPAR2 also couples to Gi/o, Gq/11, and G12/13, LPAR3 primarily couples to Gi/o and Gq/11 but not significantly to G12/13. LPAR4 uniquely couples to Gs, promoting cAMP production rather than inhibiting it like LPAR1 .

How does LPA binding to bovine LPAR1 affect gene expression in reproductive tissues?

LPA binding to bovine LPAR1 significantly alters gene expression profiles in reproductive tissues, particularly in cumulus-oocyte complexes (COCs). Research has demonstrated that supplementation of maturation medium with LPA (10⁻⁵ M) for 24 hours induces specific transcriptional changes :

  • In oocytes: LPA stimulation increases mRNA abundance of:

    • FST (follistatin), a key regulator of folliculogenesis

    • GDF9 (growth differentiation factor 9), an oocyte-secreted factor critical for cumulus expansion and oocyte maturation

  • In cumulus cells: LPA treatment decreases mRNA abundance of CTSs (cathepsins), suggesting modified proteolytic activity

  • Apoptosis-related genes: LPA stimulation of bovine oocytes leads to:

    • Increased transcription of BCL2 (anti-apoptotic factor)

    • Decreased transcription of BAX (pro-apoptotic factor)

    • Significantly lower BAX/BCL2 ratio, indicating enhanced cell survival signaling

These gene expression changes suggest that LPA signaling through LPAR1 promotes oocyte quality and survival, although this improved competence didn't translate to enhanced in vitro development to the blastocyst stage in the reported study .

What role does bovine LPAR1 play in reproductive physiology and embryonic development?

Bovine LPAR1 plays multifaceted roles in reproductive physiology and embryonic development, functioning as part of an autocrine and/or paracrine signaling network between oocytes and cumulus cells . Key functions include:

  • Oocyte maturation support: LPAR1 mediates LPA signaling that enhances oocyte competence through upregulation of critical developmental genes like FST and GDF9 .

  • Anti-apoptotic protection: By modulating the BAX/BCL2 ratio, LPAR1 signaling appears to protect oocytes from apoptosis during maturation .

  • Cumulus cell function regulation: LPA-LPAR1 signaling affects gene expression in cumulus cells, including downregulation of cathepsins, suggesting coordinated regulation of the cumulus-oocyte complex .

  • Potential influence on embryo survival: While LPA supplementation during in vitro maturation did not enhance blastocyst development rates at day 7, the improved oocyte competence induced by LPAR1 signaling may be relevant for subsequent in vivo embryo survival .

  • Developmental signaling: Based on data from other species, LPAR1 likely contributes to early embryonic development processes including cell proliferation, differentiation, and morphogenesis .

How can CRISPR-Cas9 technology be utilized to study bovine LPAR1 function?

CRISPR-Cas9 technology offers powerful approaches for elucidating bovine LPAR1 function through precise genetic manipulation:

  • Knockout studies in bovine cell lines:

    • Design multiple guide RNAs targeting exon 2-3 of bovine LPAR1 to create frameshift mutations

    • Validate knockout efficiency through sequencing, RT-PCR, and Western blotting

    • Compare phenotypic changes in proliferation, migration, and LPA-responsive signaling pathways between wildtype and LPAR1-knockout cells

  • Knock-in reporter systems:

    • Generate fluorescent protein fusions (e.g., GFP-LPAR1) to track receptor localization and trafficking

    • Insert luciferase reporters downstream of LPAR1 promoter to monitor expression regulation

    • Create epitope-tagged LPAR1 versions for improved detection in the absence of reliable antibodies

  • Domain-specific mutations:

    • Introduce point mutations at key residues (R3.28A, K7.36A, and Q3.29A) identified as critical for LPA interaction

    • Generate truncated versions to assess the functional importance of specific receptor domains

    • Create bovine versions of the naturally occurring variant (similar to murine mrec1.3) with 18-amino acid N-terminal deletion

  • In vivo applications in bovine embryos:

    • Microinject CRISPR-Cas9 components targeting LPAR1 into bovine zygotes

    • Assess development rates, gene expression patterns, and apoptosis markers

    • Compare findings with mouse knockout models to identify species-specific differences

What are the challenges and solutions in developing specific pharmacological modulators for bovine LPAR1?

Developing specific pharmacological modulators for bovine LPAR1 involves addressing several challenges:

Challenges:

  • Receptor similarity: High homology between LPAR1-3 (50-60% amino acid identity) makes selective targeting difficult

  • Species differences: Subtle sequence variations between bovine and human LPAR1 may affect ligand binding properties

  • Membrane protein: The seven transmembrane structure complicates in silico drug design

  • Validation limitations: Lack of validated antibodies hampers confirmation of target engagement

  • Multiple signaling pathways: LPAR1 couples to various G proteins, making it difficult to selectively modulate specific downstream effects

Solutions:

  • Structure-based design: Utilize homology modeling based on related GPCR crystal structures, focusing on the second extracellular loop that has been identified as important for ligand binding

  • High-throughput screening: Develop bovine LPAR1-expressing cell lines with pathway-specific reporters (calcium flux, cAMP, or ERK phosphorylation) to screen compound libraries

  • Validation approaches:

    • Competitive binding assays with radiolabeled LPA

    • Functional selectivity assessment across multiple signaling pathways

    • Cross-reactivity testing against other LPA receptors (LPAR2-6)

  • Allosteric modulators: Target receptor sites distinct from the orthosteric LPA binding site to achieve greater selectivity

  • Cross-species testing: Compare efficacy between bovine and human LPAR1 to identify compounds with conserved activity

How can single-cell transcriptomics be used to investigate LPAR1 expression patterns in bovine embryos?

Single-cell transcriptomics offers sophisticated approaches to map LPAR1 expression dynamics in bovine embryonic development:

  • Developmental trajectory analysis:

    • Isolate individual cells from various bovine embryonic stages (zygote to blastocyst)

    • Perform single-cell RNA-seq to quantify LPAR1 and related pathway components

    • Apply pseudotime analysis to construct developmental trajectories showing when LPAR1 expression initiates, peaks, and potentially shifts between cell lineages

  • Lineage-specific expression mapping:

    • At blastocyst stage, identify differential expression of LPAR1 between inner cell mass and trophectoderm

    • Correlate LPAR1 expression with known lineage markers to determine if expression is lineage-restricted

    • Integrate with spatial transcriptomics to preserve spatial context of expression patterns

  • Regulatory network reconstruction:

    • Perform co-expression analysis to identify genes whose expression correlates with LPAR1

    • Use computational approaches to infer transcription factors potentially regulating LPAR1 expression

    • Map the entire LPA signaling network (ATX, PLAs, all LPARs) at single-cell resolution to understand pathway redundancy and specialization

  • Perturbation analysis:

    • Combine single-cell transcriptomics with LPA supplementation or LPAR1 inhibition

    • Assess global transcriptional changes following perturbation

    • Identify primary and secondary response genes to distinguish direct LPAR1 targets from downstream effects

    • Compare with the known effects on BCL2, BAX, FST, and GDF9 expression documented in bulk RNA studies

How does bovine LPAR1 signaling differ between normal physiological conditions and pathological states?

Although the search results don't specifically address bovine LPAR1 in pathological states, comparative analysis with other species suggests important differences between physiological and pathological LPAR1 signaling:

Under normal physiological conditions in bovine systems, LPAR1 signaling likely:

  • Maintains homeostatic balance in reproductive tissues through regulated LPA production

  • Supports oocyte maturation via controlled expression of developmental factors like FST and GDF9

  • Regulates apoptosis through balanced BAX/BCL2 expression

  • Participates in normal tissue development and cell migration

In pathological states, based on data from other species, LPAR1 signaling can become dysregulated through:

  • Altered LPA production, potentially through increased activity of LPA-producing enzymes like autotaxin (ATX)

  • Changed receptor expression levels or distribution patterns

  • Disrupted downstream signaling pathway regulation

  • Enhanced pro-fibrotic signaling, as evidenced by the role of LPAR1 in dermal and lung fibrosis in other species

These pathological alterations in LPAR1 signaling may contribute to reproductive disorders, fibrotic conditions, or developmental abnormalities in bovine systems, similar to the roles observed in human and murine disease models.

What are the implications of LPAR1 dysfunction for bovine reproductive disorders?

While the search results don't directly address bovine reproductive disorders related to LPAR1 dysfunction, we can extrapolate from the provided data on LPAR1's role in bovine oocyte maturation:

Potential implications of LPAR1 dysfunction for bovine reproduction include:

  • Compromised oocyte quality: Since LPA-LPAR1 signaling increases FST and GDF9 expression in oocytes , dysfunction may reduce these critical developmental factors, potentially leading to poor oocyte competence.

  • Increased oocyte apoptosis: LPAR1 activation promotes a favorable BAX/BCL2 ratio for cell survival . Dysfunction might increase apoptotic susceptibility of oocytes and early embryos.

  • Disrupted cumulus-oocyte communication: LPAR1 mediates autocrine/paracrine signaling between oocyte and cumulus cells . Dysfunction could impair this communication, affecting cumulus expansion and oocyte maturation.

  • Reduced fertility: Given LPAR1's role in improving oocyte competence and potentially subsequent in vivo survival , dysfunction might contribute to reduced conception rates or early embryonic loss.

  • Altered follicular development: If LPAR1 dysfunction affects the FST-activin-follistatin system, it could disrupt normal follicular development patterns.

  • Implantation failures: Based on LPAR1's known roles in other species, dysfunction might affect uterine receptivity or embryo implantation processes.

How do environmental factors influence bovine LPAR1 expression and function?

While the search results don't directly address environmental influences on bovine LPAR1, integrating what is known about LPAR1 regulation in other systems suggests several potential environmental factors that might affect its expression and function:

  • Hypoxic conditions: In other systems, LPAR1 has been implicated in responses to hypoxia . In bovine reproductive tissues, oxygen tension fluctuations during follicular development or in vitro culture conditions may alter LPAR1 expression or signaling.

  • Inflammatory mediators: Since LPAR1 contributes to inflammatory processes in various tissues , exposure to inflammatory cytokines or pathogen-associated molecular patterns might modulate LPAR1 expression in bovine cells.

  • Hormonal environment: While not directly addressed in the search results, reproductive hormones likely influence LPAR1 expression in bovine reproductive tissues, similar to other reproductive receptors.

  • In vitro culture conditions: For assisted reproductive technologies, media composition, including presence of serum (which contains LPA) or specific supplements, may affect LPAR1 signaling during embryo development.

  • Stress factors: Environmental stressors could potentially alter LPAR1 expression or the production of its ligand LPA, as stress responses often involve GPCR signaling pathway modulation.

  • Diet and metabolic factors: Nutritional status affects reproductive function in cattle, and this may partially involve LPAR1 signaling pathways, particularly given LPA's role as a lipid mediator.

How might recombinant bovine LPAR1 be utilized in reproductive biotechnology?

Recombinant bovine LPAR1 offers several potential applications in reproductive biotechnology:

  • Culture media optimization: Addition of purified LPAR1 protein in soluble form could potentially sequester excessive LPA in culture media, allowing researchers to control LPA signaling during in vitro maturation or embryo culture.

  • Diagnostic tool development: Recombinant LPAR1 could be used to develop binding assays for measuring LPA levels in follicular fluid, potentially serving as biomarkers for oocyte quality or developmental competence.

  • Novel selection approaches: Based on the finding that LPA-LPAR1 signaling improves oocyte competence , detection of LPAR1-related markers might provide new selection criteria for identifying high-quality oocytes for in vitro fertilization programs.

  • Targeted drug discovery platforms: Recombinant bovine LPAR1 could serve as a screening tool for identifying compounds that specifically modulate receptor function, potentially leading to new additives for improving in vitro maturation outcomes.

  • Functionalized surfaces: Immobilized recombinant LPAR1 on culture surfaces could create spatially controlled LPA signaling environments for specialized embryo culture systems.

  • LPAR1-targeted nanodelivery systems: Conjugating embryo-supporting compounds to LPAR1-binding moieties could enable targeted delivery to cumulus-oocyte complexes expressing the receptor.

What are the potential applications of LPAR1 agonists or antagonists in bovine research and biotechnology?

LPAR1 agonists and antagonists present diverse applications in bovine research and biotechnology:

Agonist applications:

  • Enhanced in vitro maturation: Specific LPAR1 agonists could potentially improve oocyte quality by mimicking the positive effects of LPA on FST and GDF9 expression and the BAX/BCL2 ratio , possibly with greater potency or stability than natural LPA.

  • Cryopreservation improvement: LPAR1 agonists might enhance cell survival signaling during cryopreservation and thawing of bovine oocytes and embryos through anti-apoptotic mechanisms.

  • Reproductive efficiency research: Controlled LPAR1 activation could help delineate specific pathways contributing to embryo quality and survival, leading to new insights for improving reproductive efficiency.

Antagonist applications:

  • Mechanistic studies: LPAR1 antagonists would provide valuable tools for dissecting the specific contribution of LPAR1 (versus other LPA receptors) in bovine reproductive physiology.

  • Development of contraceptive approaches: If LPAR1 proves essential for bovine reproduction, antagonists might have applications in temporal fertility control for research purposes.

  • Anti-fibrotic applications: Based on evidence from other species that LPAR1 inhibition reduces fibrosis , antagonists might have applications in treating bovine fibrotic conditions.

  • Developing research models: LPAR1 antagonists could create pharmacological "knockdown" models to complement genetic approaches in studying receptor function.

What emerging technologies will advance our understanding of bovine LPAR1 biology in the next decade?

Several emerging technologies are poised to transform our understanding of bovine LPAR1 biology:

  • Cryo-electron microscopy: This rapidly advancing technique will likely enable determination of the complete bovine LPAR1 structure, including ligand-binding domains and conformational changes upon activation, facilitating structure-based drug design.

  • Spatial multi-omics: Integration of spatial transcriptomics, proteomics, and metabolomics will map LPAR1 expression and activity in three-dimensional tissue contexts, providing unprecedented insights into its localization and function within the bovine reproductive tract.

  • Organoid technologies: Development of bovine reproductive tract organoids expressing LPAR1 will enable controlled studies of receptor function in physiologically relevant 3D microenvironments that better recapitulate in vivo conditions.

  • CRISPR-based epigenome editing: Beyond gene knockout, precise modification of epigenetic marks regulating bovine LPAR1 expression will allow nuanced manipulation of its expression patterns without eliminating the gene entirely.

  • Optogenetic and chemogenetic tools: Development of light-activated or designer drug-activated versions of bovine LPAR1 will enable temporal and spatial control of receptor activation in specific cell populations.

  • Single-cell multimodal analyses: Combined measurement of transcriptome, proteome, and signaling pathway activation at single-cell resolution will reveal heterogeneity in LPAR1 expression and function across different cell types within complex tissues.

  • AI-driven structural biology: Machine learning approaches will accelerate prediction of LPAR1-interacting proteins and compound screening, potentially identifying novel endogenous modulators and therapeutic candidates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.