Recombinant Bovine Lysoplasmalogenase-like protein TMEM86A (TMEM86A)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
TMEM86A; Lysoplasmalogenase-like protein TMEM86A; Transmembrane protein 86A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM86A
Target Protein Sequence
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGLG
FLLTHPSATRIFVGLVFSAIGDAFLIWQDQGYFVHGMLMFAVTHMLYASAFGMRPLGLRT
GLLMVILSGLCYAFLYPNLTGAFTYVVGVYVAIIGFMGWRAMAGLQLVGAAWRWTELAAG
TGALLFIVSDLTIALDKFCFPVPYSRALIMSTYYAAQMLIALSAVESREPVEDYRLSKAK
Uniprot No.
Target Background
Database Links
Protein Families
TMEM86 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
