Recombinant Bovine Lysosomal-associated transmembrane protein 4B (LAPTM4B)

Shipped with Ice Packs
In Stock

Description

Lysosomal Function and Autophagy

  • Autophagic Flux Regulation: LAPTM4B promotes autophagy by maintaining lysosomal pH via V-ATPase activation, enhancing stress tolerance in cancer cells .

  • Amino Acid Transport: Recruits LAT1-4F2hc leucine transporters to lysosomes, stimulating mTORC1 signaling .

Oncogenic Properties

  • Cancer Progression: Overexpressed in hepatocellular carcinoma (HCC), breast, and lung cancers, LAPTM4B drives proliferation, metastasis, and chemoresistance .

  • Mechanistic Insights:

    • Inhibits YAP phosphorylation, stabilizing it to promote stemness in HCC .

    • Blocks EGFR degradation, amplifying oncogenic signaling .

Immune Modulation

  • TGF-β1 Regulation: In human regulatory T cells (Tregs), LAPTM4B binds GARP to suppress TGF-β1 secretion, reducing immunosuppression .

Recombinant LAPTM4B Production

While recombinant bovine LAPTM4B-specific protocols are not explicitly documented, methodologies for human homologs provide a template:

ParameterHuman LAPTM4B Example
Expression SystemWheat germ
Protein Range1–226 amino acids (LAPTM4B-24 isoform)
ApplicationsELISA, Western blot, functional assays
Key InteractionsEGFR, mTORC1, LAT1-4F2hc, GARP

Bovine LAPTM4B recombinant protein would likely require codon optimization for expression in systems like E. coli, insect cells, or mammalian cells to ensure proper post-translational modifications.

Cancer Therapeutics

  • Targeted Inhibition: Silencing LAPTM4B reduces tumor growth, invasion, and angiogenesis in cervical cancer models .

  • Chemoresistance: Overexpression correlates with anthracycline resistance by sequestering drugs in lysosomes .

Cardiovascular Protection

  • Myocardial Ischemia/Reperfusion (I/R) Injury: LAPTM4B downregulation impairs autophagic flux, exacerbating cell death. Overexpression protects via mTORC1/TFEB pathway modulation .

Challenges and Future Directions

  • Species-Specific Variations: Bovine LAPTM4B may exhibit functional differences in lysosomal trafficking or immune interactions compared to human isoforms.

  • Therapeutic Development: Small-molecule inhibitors targeting LAPTM4B’s transmembrane domains or its interaction with YAP/EGFR could broaden cancer treatment options .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate your needs in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize the development of your specified tag.
Synonyms
LAPTM4B; Lysosomal-associated transmembrane protein 4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
LAPTM4B
Target Protein Sequence
MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLILNAVVLLILLSALADPDHYHFSSSEL GGDFEFMDDANMCIAIAISVLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNTLVAV TVLVYPNSIQEYIRQLPPDFPYKDDIMSVNPTCLVLIILLFISIILAFKGYLISCVWNCY RYINGRNSSDVLVYVTSNDSTVLLPPYDDATVNSATKEPPPPYVSA
Uniprot No.

Target Background

Function
LAPTM4B is crucial for optimal lysosomal function. It inhibits EGF-stimulated EGFR intraluminal sorting and degradation. Furthermore, by binding to phosphatidylinositol 4,5-bisphosphate, it regulates the interaction with PIP5K1C, inhibiting HGS ubiquitination and relieving LAPTM4B's inhibition of EGFR degradation. LAPTM4B recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, facilitating the entry of leucine and other essential amino acids (EAAs) into the lysosome. This action stimulates the activation of the proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase), ultimately leading to mTORC1 activation. Additionally, LAPTM4B serves as a negative regulator of TGFB1 production in regulatory T cells. It binds ceramide and promotes its exit from the late endosome, thereby controlling cell death pathways.
Gene References Into Functions
  1. This study reveals, for the first time, that bovine LAPTM4B in granulosa cells exists in both unubiquinated and ubiquinated forms, with differential expression in developing ovarian follicles. PMID: 25881887
  2. LAPTM4B exhibits differential expression at both the mRNA and protein levels across various bovine tissues. The mRNA translates into a 26.3 kDa protein that undergoes mono-ubiquitination, resulting in a 31.5 kDa isoform. Immunohistochemical analysis revealed that LAPTM4B expression varies considerably among tissues and even among similar and adjacent cell types. LAPTM4B may contribute to protection against the accumulation of metabolic byproducts. PMID: 25881887
Database Links

KEGG: bta:404155

STRING: 9913.ENSBTAP00000022559

UniGene: Bt.1143

Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.
Tissue Specificity
Strongly expressed in fetal ovary, testis, adrenal gland, liver and uterus, and weakly expressed in the spleen.

Q&A

What is LAPTM4B and what are its primary cellular functions?

LAPTM4B (Lysosomal-associated transmembrane protein 4B) is a membrane protein that primarily localizes to lysosomes and plays multiple roles in cellular function. Research has established that LAPTM4B serves as a negative regulator of TGF-β1 production in human regulatory T cells (Tregs). LAPTM4B binds to glycoprotein A repetitions predominant (GARP), inhibiting the cleavage of proTGF-β1, reducing secretion of latent TGF-β1, and decreasing surface presentation of GARP·TGF-β1 complexes . This protein is expressed at higher levels in Tregs compared to Th cells, suggesting tissue-specific expression patterns that contribute to immune regulation. While initially characterized for its oncogenic properties in tumor cells, it has emerged as an important player in immune system regulation, making it a potential therapeutic target for modulating immunosuppression by Tregs .

What are the known isoforms of LAPTM4B and how do they differ?

LAPTM4B has multiple isoforms that result from alternative translation initiation through a mechanism known as leaky scanning. This mechanism allows translation to begin at different AUG codons within the same mRNA. The primary LAPTM4B isoforms that have been characterized include:

IsoformMolecular WeightEncoding VariantsStructural Characteristics
LAPTM4B iso3535 kDaRefSeq variant onlyContains full N-terminal sequence
LAPTM4B iso2424 kDaRefSeq and Va variantsTruncated N-terminus compared to iso35
LAPTM4B iso2020 kDaRefSeq, Va, and Vb variantsLacks first 66 amino acids of iso24

Regulatory T cells (Tregs) predominantly express the Va and Vb variants but not the RefSeq variant, suggesting that LAPTM4B iso24 and LAPTM4B iso20 are the primary isoforms present in Tregs . This differential expression of LAPTM4B isoforms across cell types points to potential functional specialization that may be relevant for targeted therapeutic interventions.

How is LAPTM4B expression regulated at the transcriptional level?

LAPTM4B expression is regulated through multiple mechanisms, including DNA and RNA methylation patterns. Research across various cancer types has demonstrated significant correlations between LAPTM4B expression and methylation status. The gene contains several regulatory elements in its promoter region that respond to different transcription factors depending on the cellular context. In immune cells, particularly Tregs, LAPTM4B is expressed at higher levels compared to other T helper cells, suggesting cell-type specific transcriptional regulation mechanisms .

DNA methylation analysis has revealed that hypomethylation of specific CpG islands in the LAPTM4B promoter correlates with increased expression in several cancer types, while transcriptional repression may occur through hypermethylation in other contexts . Understanding these regulatory mechanisms is crucial for developing potential therapeutic strategies targeting LAPTM4B expression.

How does LAPTM4B interact with GARP to regulate TGF-β1 production in Tregs?

LAPTM4B directly interacts with GARP (glycoprotein A repetitions predominant) to regulate TGF-β1 production in regulatory T cells. This interaction was identified through yeast two-hybrid assays where GARP was used as bait to screen a human Treg cDNA library . The functional significance of this interaction has been established through several mechanistic studies:

  • Inhibition of proTGF-β1 cleavage: LAPTM4B significantly decreases the GARP-induced cleavage of proTGF-β1 into latent TGF-β1. This effect appears to be specific to the GARP-proTGF-β1 interaction rather than through general inhibition of FURIN activity, as LAPTM4B does not affect the cleavage of other FURIN substrates like proIGF1R .

  • Reduction of latent TGF-β1 secretion: LAPTM4B reduces latent TGF-β1 secretion by approximately 54% in cells expressing both GARP and TGF-β1. Interestingly, this regulatory effect also occurs in the absence of GARP, suggesting multiple mechanisms by which LAPTM4B influences TGF-β1 production .

  • Down-regulation of surface GARP levels: LAPTM4B reduces surface levels of GARP by approximately 45-67% and surface LAP (latency-associated peptide, a component of latent TGF-β1) by 73% when co-expressed with GARP and TGF-β1 .

These findings suggest that LAPTM4B serves as a negative regulator of TGF-β1 production in Tregs, potentially by directing GARP to lysosomal degradation pathways through its C-terminal polyproline-tyrosine (PY) motifs, similar to how other LAPTM family members regulate surface receptor levels .

What experimental approaches are most effective for studying LAPTM4B-GARP interactions in primary Treg cells?

To effectively study LAPTM4B-GARP interactions in primary Treg cells, researchers should consider a multi-faceted approach combining molecular, cellular, and functional techniques:

  • Co-immunoprecipitation and proximity ligation assays: These methods can verify the physical interaction between LAPTM4B and GARP in primary Tregs under physiological conditions. When antibody availability is limited, epitope tagging through lentiviral transduction of primary Tregs may be necessary, though careful validation is required to ensure normal protein function is maintained .

  • CRISPR-Cas9 gene editing: Generation of LAPTM4B knockout or knockdown Tregs allows for functional assessment of how LAPTM4B deficiency affects GARP expression, TGF-β1 processing, and Treg immunosuppressive capacity. Comparison of results from primary cells with those from transfected cell lines (like 293T) helps validate physiological relevance .

  • Flow cytometry and confocal microscopy: These techniques are essential for quantifying surface and intracellular expression of GARP and LAPTM4B, as well as their co-localization patterns, which primarily occur in the median Golgi apparatus rather than lysosomes as might be expected .

  • TGF-β1 production and activity assays: Quantification of proTGF-β1 cleavage (by Western blot), latent TGF-β1 secretion (by ELISA), and TGF-β1 activation (using reporter cell lines with CAGA-LUC constructs) provides comprehensive assessment of how LAPTM4B affects the entire TGF-β1 production pathway .

A comparative analysis of different Treg subsets with varying LAPTM4B expression levels would provide additional insights into the physiological relevance of this regulatory mechanism.

How might LAPTM4B modulation affect Treg function in autoimmune disease models?

Modulation of LAPTM4B expression or function in Tregs could significantly impact autoimmune disease progression through several mechanisms:

  • Enhanced immunosuppression with LAPTM4B inhibition: Since LAPTM4B negatively regulates TGF-β1 production in Tregs, its inhibition might enhance Treg immunosuppressive capacity by increasing active TGF-β1 levels. This could potentially ameliorate autoimmune pathology in conditions where Treg dysfunction contributes to disease progression .

  • Altered Treg stability and plasticity: LAPTM4B's influence on TGF-β1 signaling might affect Treg stability and resistance to conversion into inflammatory T cell phenotypes. In autoimmune environments where Treg instability is problematic, LAPTM4B inhibition could promote more stable Treg phenotypes through enhanced TGF-β1 signaling .

  • Effects on tissue-specific Treg populations: Different autoimmune diseases involve tissue-specific Treg populations that may have varying LAPTM4B expression patterns. Targeted modulation of LAPTM4B in specific Treg subsets could provide tissue-specific therapeutic effects while minimizing systemic immunosuppression .

  • Interaction with the tumor microenvironment: In autoimmune conditions with increased cancer risk (like inflammatory bowel disease), careful consideration of LAPTM4B's dual role in immune regulation and oncogenesis is necessary, as inhibiting LAPTM4B might enhance immunosuppression while potentially affecting tumor surveillance .

Experimental approaches to test these hypotheses would include conditional knockout of LAPTM4B in Foxp3+ cells in various autoimmune disease models, followed by comprehensive assessment of disease progression, Treg function, and cytokine profiles.

What is the expression pattern of LAPTM4B across different cancer types and what are the implications for prognosis?

LAPTM4B expression varies significantly across cancer types and has important prognostic implications:

Cancer TypeLAPTM4B Expression PatternPrognostic AssociationReference
Ph+ B-ALLSignificantly elevated compared to normal cellsPoor prognosis, associated with disease progression
Various solid tumorsIncreased expression in multiple cancer typesSignificant association with clinical outcomes and survival
LeukemiaExpressed in stem cells, associated with specific subtypesPredictive of disease progression

Comprehensive pan-cancer analysis has revealed that LAPTM4B expression correlates with DNA and RNA methylation patterns across cancer types. Higher LAPTM4B expression is frequently associated with drug resistance mechanisms, potentially through its roles in lysosomal function and cellular trafficking pathways . Furthermore, knockout studies have demonstrated that loss of LAPTM4B impedes B-cell acute lymphoblastic leukemia (B-ALL) progression in mouse models and reduces cell proliferation in vitro, supporting its role as a driver of oncogenesis .

These findings suggest that LAPTM4B expression analysis could serve as a valuable prognostic biomarker in multiple cancer types, potentially guiding treatment decisions and risk stratification.

How does LAPTM4B influence the tumor immune microenvironment and response to immunotherapy?

LAPTM4B plays a significant role in shaping the tumor immune microenvironment (TIME) through several mechanisms:

These findings suggest that LAPTM4B status could potentially predict response to immunotherapy, with high expression potentially indicating immunosuppressive microenvironments in some cancer contexts. Developing combination strategies targeting both LAPTM4B and immune checkpoint pathways might enhance therapeutic efficacy.

What are the current methodologies for targeting LAPTM4B in cancer therapeutics research?

Current methodologies for targeting LAPTM4B in cancer therapeutics research encompass several innovative approaches:

  • Genetic knockdown/knockout strategies: CRISPR-Cas9 and shRNA approaches have successfully demonstrated that reduction of LAPTM4B expression impedes cancer progression in models of B-ALL. In vitro studies show that LAPTM4B knockout reduces cell proliferation and causes G0/G1 cell cycle arrest . These genetic approaches provide proof-of-concept for LAPTM4B targeting but require effective delivery systems for clinical translation.

  • Small molecule inhibitors: Development of small molecules that could disrupt LAPTM4B interactions with its binding partners (such as GARP) or interfere with its lysosomal localization through targeting of its PY motifs. Structure-based drug design approaches are hampered by limited structural information on LAPTM4B, making high-resolution structural studies a priority .

  • Antibody-based approaches: Monoclonal antibodies targeting LAPTM4B extracellular domains could potentially block its interactions or induce its internalization and degradation. These approaches might be particularly valuable for combination with existing immunotherapies.

  • Exploiting LAPTM4B in drug delivery: Given LAPTM4B's role in lysosomal function, it could potentially be exploited to enhance delivery of lysosome-targeted cancer therapeutics, particularly in cancers with high LAPTM4B expression.

  • Combination therapies: The association between LAPTM4B expression and drug resistance suggests potential benefits from combining LAPTM4B inhibitors with conventional chemotherapies or targeted agents to enhance treatment efficacy .

A key consideration for all these approaches is the differential expression of LAPTM4B isoforms across tissues and cell types, which may necessitate isoform-specific targeting strategies to maximize efficacy while minimizing off-target effects.

What are the challenges in producing and purifying recombinant bovine LAPTM4B protein?

Production and purification of recombinant bovine LAPTM4B present several technical challenges:

  • Membrane protein expression barriers: As a lysosomal membrane protein with multiple transmembrane domains, LAPTM4B is challenging to express in soluble form. Researchers must choose between:

    • Full-length protein expression in mammalian systems (preferred for maintaining post-translational modifications but with lower yields)

    • Truncated constructs focusing on specific domains (higher yields but potentially altered functionality)

    • Fusion protein approaches (such as MBP or SUMO tags) to enhance solubility

  • Proper folding and post-translational modifications: LAPTM4B requires appropriate glycosylation and disulfide bond formation, making prokaryotic expression systems suboptimal. Insect cell or mammalian expression systems are preferred but introduce additional complexity and cost.

  • Purification strategy optimization: Effective purification typically requires:

    • Initial detergent screening to identify optimal solubilization conditions

    • Multi-step purification incorporating immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

    • Careful detergent exchange during purification to maintain protein stability while removing harsh solubilizing detergents

  • Isoform-specific production: Generating specific LAPTM4B isoforms (iso35, iso24, or iso20) requires careful design of expression constructs to ensure translation initiation at the desired start codon .

  • Functional validation: Confirming that the recombinant protein retains native binding properties, particularly the interaction with GARP and effects on TGF-β1 processing, is essential for meaningful experimental applications .

Development of a robust expression and purification protocol typically requires systematic optimization of multiple parameters including expression host, construct design, induction conditions, and purification buffers.

How can researchers effectively measure LAPTM4B-mediated effects on TGF-β1 processing in experimental systems?

To effectively measure LAPTM4B-mediated effects on TGF-β1 processing, researchers should implement a comprehensive experimental approach:

  • ProTGF-β1 cleavage assessment by Western blot analysis:

    • Transfect cells with combinations of TGFB1, GARP, and LAPTM4B expression constructs

    • Prepare cell lysates and perform SDS-PAGE under reducing conditions

    • Probe blots with antibodies specific to proTGF-β1, LAP, and mature TGF-β1

    • Quantify the relative abundance of each form to assess cleavage efficiency

  • Latent TGF-β1 secretion measurement:

    • Collect supernatants from transfected cells after 24-48 hours

    • Quantify latent TGF-β1 using commercially available ELISA kits

    • Compare secretion levels between LAPTM4B-expressing and control cells

  • Surface GARP and GARP·latent TGF-β1 complex quantification:

    • Perform flow cytometry on non-permeabilized cells using antibodies against GARP and LAP

    • Calculate mean fluorescence intensity to determine surface protein levels

    • Include appropriate controls (such as CD9 or HLA-A2) to confirm specificity of LAPTM4B effects

  • TGF-β1 activation reporter assays:

    • Utilize reporter cell lines expressing luciferase under control of a CAGA promoter responsive to SMAD2/3 activation

    • Co-culture these reporters with cells expressing various combinations of GARP, TGF-β1, and LAPTM4B

    • Measure luciferase activity as an indicator of active TGF-β1 production

    • Include positive controls such as integrin β6 expression or recombinant active TGF-β1

  • FURIN activity assessment:

    • Measure FURIN activity using fluorogenic substrates

    • Simultaneously assess processing of other FURIN substrates (like proIGF1R) to determine specificity of LAPTM4B effects

These complementary approaches provide a comprehensive assessment of how LAPTM4B influences multiple stages of TGF-β1 processing, from initial cleavage to activation.

What are the key considerations for designing knockout or knockdown experiments targeting LAPTM4B?

Designing effective knockout or knockdown experiments targeting LAPTM4B requires careful consideration of several factors:

  • Isoform specificity:

    • LAPTM4B exists in multiple isoforms (iso35, iso24, iso20) with potentially distinct functions

    • Design knockout strategies that target shared exons to eliminate all isoforms

    • For isoform-specific studies, use precise gene editing to target specific start codons or implement RNA interference approaches with isoform-specific siRNAs

  • Model system selection:

    • Cell line models: Choose cells with endogenous LAPTM4B expression relevant to the research question (e.g., Tregs for immune studies, Ph+ B-ALL cells for leukemia studies)

    • Animal models: Consider conditional knockout approaches (e.g., Cre-loxP) to study tissue-specific effects and avoid developmental consequences

    • Patient-derived samples: When possible, use primary cells from patients to validate findings from model systems

  • Technical approach optimization:

    • CRISPR-Cas9: Design multiple guide RNAs targeting conserved exons; screen for off-target effects

    • shRNA/siRNA: Validate knockdown efficiency at both mRNA and protein levels; include scrambled controls

    • Inducible systems: Consider doxycycline-inducible approaches for temporal control of LAPTM4B depletion

  • Functional validation assays:

    • In immune contexts: Measure TGF-β1 processing, Treg suppressive capacity, and cytokine production

    • In cancer contexts: Assess proliferation, cell cycle progression (particularly G0/G1 arrest), and tumor progression in xenograft models

  • Rescue experiments:

    • Reintroduce wild-type or mutant LAPTM4B to confirm phenotype specificity

    • Use isoform-specific complementation to delineate the roles of different LAPTM4B variants

  • Controls for compensatory mechanisms:

    • Assess expression of other LAPTM family members that might compensate for LAPTM4B loss

    • Monitor expression of proteins with overlapping functions in TGF-β1 regulation or lysosomal function

Implementation of these considerations has proven successful in demonstrating that knockout of LAPTM4B impedes B-ALL progression in mice and reduces cell proliferation in vitro, providing a model for future mechanistic studies .

How might single-cell analysis technologies advance our understanding of LAPTM4B function in heterogeneous cell populations?

Single-cell analysis technologies offer transformative potential for advancing our understanding of LAPTM4B function in heterogeneous populations:

  • Single-cell RNA sequencing (scRNA-seq) can reveal previously undetected cell-type specific expression patterns of LAPTM4B isoforms. This is particularly valuable for understanding the differential expression between regulatory T cell subsets and other immune cell populations, potentially identifying specialized Treg populations with unique LAPTM4B expression patterns .

  • Single-cell proteomics and phosphoproteomics can map LAPTM4B's involvement in signaling networks at the individual cell level, potentially revealing cell state-dependent interactions that would be masked in bulk analyses. This could clarify how LAPTM4B influences TGF-β1 processing pathways in different cellular contexts .

  • Spatial transcriptomics and proteomics technologies can reveal tissue-specific expression patterns of LAPTM4B, particularly in tumor microenvironments where spatial relationships between immune and tumor cells are crucial. This approach could identify niches where LAPTM4B-expressing cells interact with other cell types to influence disease progression .

  • Combined single-cell multi-omics approaches that simultaneously measure genome, transcriptome, and proteome from the same cells could reveal how genetic or epigenetic regulation of LAPTM4B varies across cell states and influences protein function. This would be particularly valuable for understanding the relationship between LAPTM4B expression and methylation patterns observed in cancer studies .

  • Trajectory inference from single-cell data could reveal how LAPTM4B expression changes during cellular differentiation or disease progression, providing insights into its roles in developmental processes and pathological transitions.

These technologies would enable construction of comprehensive cell atlases mapping LAPTM4B expression and function across healthy and diseased tissues, potentially identifying new therapeutic opportunities.

What are the promising avenues for developing LAPTM4B-targeted therapeutics for autoimmune diseases?

Several promising avenues exist for developing LAPTM4B-targeted therapeutics for autoimmune diseases:

  • Small molecule inhibitors of LAPTM4B-GARP interaction: Development of compounds that disrupt the binding between LAPTM4B and GARP could potentially enhance TGF-β1 production by Tregs, increasing their immunosuppressive capacity in autoimmune settings . High-throughput screening of compound libraries against this protein-protein interaction, followed by medicinal chemistry optimization, represents a feasible approach.

  • Lysosomal targeting modifiers: Compounds that interfere with LAPTM4B's lysosomal targeting via its C-terminal polyproline-tyrosine (PY) motifs could potentially alter its regulatory effects on GARP and TGF-β1 processing . This approach might leverage existing knowledge about the cellular trafficking machinery that recognizes these motifs.

  • Isoform-specific targeting strategies: Development of therapeutics that selectively target specific LAPTM4B isoforms (iso24 or iso20) that are predominantly expressed in Tregs could provide cell-type specificity, potentially minimizing off-target effects in other tissues .

  • Cell-based therapies: Engineering Tregs with modified LAPTM4B expression for adoptive cell therapy could enhance their stability and suppressive function for treating autoimmune conditions. CRISPR-based approaches for LAPTM4B knockdown in ex vivo expanded Tregs might improve their therapeutic efficacy .

  • Combination approaches: LAPTM4B-targeted therapies could be combined with existing immunomodulatory drugs to enhance efficacy. For example, combining LAPTM4B inhibition (to enhance Treg function) with low-dose IL-2 (to promote Treg expansion) might provide synergistic benefits in conditions like rheumatoid arthritis or inflammatory bowel disease.

The development of these therapeutic approaches would benefit from improved understanding of LAPTM4B's role in different autoimmune disease contexts and careful consideration of potential oncogenic effects given its role in cancer biology .

How might comparative genomics approaches inform our understanding of LAPTM4B evolution and function across species?

Comparative genomics approaches offer valuable insights into LAPTM4B evolution and function:

  • Evolutionary conservation analysis: Comparison of LAPTM4B sequences across species reveals highly conserved functional domains and species-specific adaptations. Preliminary analyses suggest that while the transmembrane domains of LAPTM4B are highly conserved across mammals, there is considerable variation in N-terminal regions, potentially explaining species-specific functions .

  • Regulatory element conservation: Analysis of promoter regions and other regulatory elements across species can identify conserved transcription factor binding sites and tissue-specific regulatory mechanisms. This approach could explain the differential expression patterns of LAPTM4B observed in immune cells versus other tissues .

  • Structural homology modeling: Using structural information from related proteins across species could facilitate the development of more accurate models of LAPTM4B's three-dimensional structure, particularly for regions lacking direct structural data. These models would aid in understanding protein-protein interactions and guide drug design efforts.

  • Functional genomics comparisons: Cross-species analyses of LAPTM4B expression patterns, particularly in immune cells, could reveal conserved versus species-specific functions. This is especially relevant when considering bovine LAPTM4B function compared to human and murine orthologs in experimental systems .

  • Paralog analysis: Examining the relationship between LAPTM4B and other LAPTM family members (such as LAPTM5) across species could reveal functional diversification within this protein family. This approach might identify complementary or compensatory mechanisms that could inform therapeutic targeting strategies .

  • Disease-associated variant analysis: Comparing natural variations in LAPTM4B across species with disease-associated variants in humans could highlight functionally critical regions and potential mechanisms of pathogenesis.

These comparative approaches would not only enhance our fundamental understanding of LAPTM4B biology but also inform the development of more effective and specific therapeutic strategies targeting this protein in various disease contexts.

How does LAPTM4B integrate into broader cellular networks regulating immune homeostasis?

LAPTM4B functions as a key regulatory node within broader cellular networks maintaining immune homeostasis through several interconnected mechanisms:

  • TGF-β1 signaling integration: By regulating TGF-β1 production in Tregs through its interaction with GARP, LAPTM4B influences a cytokine pathway central to immune tolerance, inflammation resolution, and tissue repair . This positions LAPTM4B as a fine-tuning mechanism for appropriate immunosuppression, preventing both excessive immune activation and overwhelming immunosuppression.

  • Lysosomal function coordination: As a lysosomal membrane protein, LAPTM4B likely participates in broader lysosomal networks that regulate protein degradation, antigen processing, and cellular metabolism. These processes are increasingly recognized as critical for immune cell function and differentiation .

  • Membrane protein trafficking regulation: LAPTM4B's effects on surface GARP levels suggest a broader role in regulating membrane protein trafficking and turnover, similar to other LAPTM family members. This function potentially extends to additional immune receptors beyond GARP .

  • Immune checkpoint modulation: The association between LAPTM4B expression and various immune parameters across cancer types suggests potential interactions with immune checkpoint pathways that regulate T cell activation and exhaustion .

  • Cell type-specific regulatory networks: Differential expression of LAPTM4B isoforms across cell types indicates integration into cell-specific regulatory networks, with particular importance in Tregs and certain cancer cells .

The emerging picture suggests that LAPTM4B serves as an immunomodulatory checkpoint that helps balance immune responses by negatively regulating a key immunosuppressive mechanism. This function has evolved within complex cellular networks maintaining the delicate balance between effective immunity and harmful inflammation.

What are the translational implications of LAPTM4B research for precision medicine approaches?

LAPTM4B research holds significant translational implications for precision medicine across multiple disease contexts:

  • Biomarker applications:

    • Prognostic stratification: LAPTM4B expression patterns could identify patient subgroups with differential disease trajectories across multiple cancer types

    • Therapy response prediction: LAPTM4B status might predict response to immunotherapies or TGF-β-targeting drugs, enabling more personalized treatment selection

    • Monitoring disease progression: Changes in LAPTM4B expression or activity could serve as biomarkers for disease evolution or treatment response

  • Therapeutic targeting opportunities:

    • Immunomodulatory approaches: Targeting LAPTM4B to enhance or inhibit Treg function depending on disease context (enhancement for autoimmunity, inhibition for cancer)

    • Combination therapy design: LAPTM4B status could inform optimal combinations of existing therapies with novel LAPTM4B-targeted approaches

    • Cell therapy optimization: Engineering of LAPTM4B expression in cell-based therapies (such as CAR-T cells or Tregs) to enhance their efficacy and persistence

  • Patient stratification for clinical trials:

    • LAPTM4B expression or genetic variation could identify patient subgroups most likely to benefit from specific therapeutic approaches

    • Matching patients to trials based on LAPTM4B-related molecular signatures could improve success rates of novel therapeutics

  • Drug repurposing opportunities:

    • Existing drugs affecting lysosomal function or membrane protein trafficking might indirectly modulate LAPTM4B activity

    • Systematic screening of approved drugs for effects on LAPTM4B function could identify rapid-translation candidates

The dual role of LAPTM4B in both immune regulation and cancer biology positions it at the intersection of oncology and immunology, making it particularly relevant for the growing field of immuno-oncology and precision medicine approaches that consider both tumor biology and immune context .

What interdisciplinary approaches would most effectively advance LAPTM4B research in the next decade?

Advancing LAPTM4B research in the next decade will require synergistic interdisciplinary approaches:

  • Integration of structural biology with computational modeling:

    • High-resolution structural determination of LAPTM4B and its complexes using cryo-EM or X-ray crystallography

    • Molecular dynamics simulations to understand conformational changes upon binding partners

    • Structure-based drug design targeting specific LAPTM4B interactions or functions

  • Systems biology and network analysis:

    • Multi-omics integration to map LAPTM4B-associated networks across cell types

    • Network perturbation studies to identify synthetic interactions and potential combination therapy targets

    • Mathematical modeling of TGF-β1 regulation pathways to predict effects of LAPTM4B modulation

  • Advanced imaging and single-cell technologies:

    • Super-resolution microscopy to visualize LAPTM4B trafficking and interactions in living cells

    • Single-cell multi-omics to characterize heterogeneity in LAPTM4B function

    • Spatial proteomics to map LAPTM4B interactions within tissue microenvironments

  • Immunology and cancer biology integration:

    • Parallel studies in immune regulation and oncogenesis to understand context-dependent functions

    • Development of models that recapitulate both immune and cancer aspects of LAPTM4B biology

    • Collaborative research between immunology and oncology specialists

  • Translational research pipelines:

    • Biobanking initiatives with comprehensive clinical data linked to LAPTM4B status

    • Early integration of companion diagnostics in therapeutic development

    • Adaptive clinical trial designs responsive to LAPTM4B-related biomarkers

  • Artificial intelligence and machine learning applications:

    • Predictive modeling of LAPTM4B function based on sequence or expression data

    • Drug discovery algorithms specifically targeting LAPTM4B interactions

    • Pattern recognition in patient data to identify LAPTM4B-associated disease subtypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.