Recombinant Bovine Lysosomal-associated transmembrane protein 5 (LAPTM5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize development according to your specifications.
Synonyms
LAPTM5; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
LAPTM5
Target Protein Sequence
MAPRAAAIRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKFSKTGYLRI AELVSSFLLITMLFIISLSLLVGVVKNREKYLLPFLSLQIMDFLLCLLTLMGSYIELPAY LKFASRSSRRVSPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQDG MTHNQFIKIMIIFSIAFITVLILKVYMFKCVWRCYRLMKCTNSAEERSGSKMLQKVVLPS YEEAVSLPYKVPEGGPAPPPYSEV
Uniprot No.

Target Background

Function
Plays a potential functional role in embryogenesis and adult hematopoietic cell processes.
Database Links
Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

What is LAPTM5 and what cellular compartments does it primarily localize to?

LAPTM5 is a lysosomal-associated protein transmembrane 5 that primarily localizes to lysosomal compartments. It is a multifunctional transmembrane protein that plays crucial roles in protein degradation pathways. LAPTM5 contains multiple transmembrane domains and has been identified among lysosomal-associated proteins through systematic screening approaches . The protein is expressed in various tissues and cell types, with significant functional implications in hepatocytes, neurons, and cancer cells as revealed by recent research .

How is LAPTM5 expression regulated under normal physiological conditions?

Under normal physiological conditions, LAPTM5 expression is tightly regulated at both transcriptional and post-translational levels. Research has shown that LAPTM5 protein expression can be dramatically altered without corresponding changes in mRNA levels, suggesting significant post-transcriptional regulation . In healthy liver tissue, LAPTM5 maintains normal expression levels, while in primary neurons under normal culture conditions, baseline LAPTM5 expression remains stable and contributes to neuronal homeostasis . The protein appears to be constitutively expressed in many cell types, providing basal protection against various cellular stressors.

What are the key experimental models used to study LAPTM5 function?

Several experimental models have been established to study LAPTM5 function:

  • In vivo models:

    • LAPTM5 knockout mice models

    • ob/ob mice

    • Wild-type mice on specialized diets (high-fat diet, high-fat high-cholesterol diet, methionine and choline-deficient diet) for NASH studies

    • Cerebral ischemia/reperfusion (I/R) injury models

  • In vitro models:

    • L02 human hepatocytes and mouse primary hepatocytes treated with palmitic acid (PA)

    • Primary neuronal cultures subjected to oxygen-glucose deprivation/reoxygenation (OGD/R)

    • HEK293T cells for transfection and protein interaction studies

  • Technical approaches:

    • Adenovirus-mediated overexpression systems (Ad-LAPTM5)

    • shRNA-mediated knockdown

    • CRISPR/Cas9 knockout systems

What role does LAPTM5 play in non-alcoholic steatohepatitis (NASH)?

LAPTM5 exhibits a protective role against NASH progression. Studies have demonstrated that LAPTM5 protein expression is significantly down-regulated in the livers of both human NASH subjects and mouse NASH models . Experimental evidence indicates that:

  • Depletion of LAPTM5 in hepatocytes significantly exacerbates hepatic steatosis, inflammation, and fibrosis in high-fat and high-cholesterol (HFHC) diet-induced mouse NASH models

  • LAPTM5 overexpression in hepatocytes substantially delays and mitigates pathological changes associated with NASH

  • Mechanistically, LAPTM5 directly interacts with the protein Cell Division Cycle 42 (CDC42) and promotes its lysosomal degradation under palmitic acid stimulation

  • When LAPTM5 expression decreases, CDC42 expression significantly increases, as confirmed in both murine and human NASH tissues

LAPTM5 functions as a protective factor in liver metabolism, and its decreased expression correlates with NASH severity, as indicated by NAS (NAFLD Activity Score) scoring .

How does LAPTM5 contribute to cancer metastasis, particularly lung-specific metastasis?

Contrary to its protective role in NASH, LAPTM5 promotes lung-specific metastasis in renal cell carcinoma (RCC). Research findings indicate that:

  • LAPTM5 sustains self-renewal and cancer stem cell-like traits of renal cancer cells by blocking the function of lung-derived bone morphogenetic proteins (BMPs)

  • Mechanistically, LAPTM5 recruits WWP2, which binds to the BMP receptor BMPR1A and mediates its lysosomal sorting, ubiquitination, and ultimate degradation

  • BMPR1A expression can be restored by the lysosomal inhibitor chloroquine, highlighting the lysosomal degradation pathway's importance

  • LAPTM5 expression serves as an independent predictor of lung metastasis in renal cancer

  • Elevated LAPTM5 expression in lung metastases appears to be common across multiple cancer types

These findings establish LAPTM5 as a critical mediator of organotropic metastasis in cancer and suggest its potential as a therapeutic target for cancers with lung metastasis.

What is the significance of LAPTM5 in cardiac hypertrophy and hypertension?

LAPTM5 has been identified as a potential diagnostic marker for hypertensive left ventricular hypertrophy (LVH). Key findings include:

  • LAPTM5 expression is significantly higher in hypertensive patients with LVH compared to normal controls

  • LAPTM5 shows strong correlations with diverse marker sets of reactive oxygen species (ROS) and autophagy pathways

  • LAPTM5 demonstrates a positive association with left ventricle wall thickness as measured by cardiac magnetic resonance imaging (CMRI)

  • Positive correlations exist between LAPTM5 expression and electrocardiogram (ECG) parameters, including widths of the QRS complex and QTc interval

  • LAPTM5 expression strongly correlates with end-systolic and end-diastolic anterior wall thickness (ESAWT, EDAWT) and posterior wall thickness (ESPWT, EDPWT)

These findings suggest LAPTM5 as a potential biomarker for the diagnosis of LVH in patients with hypertension and provide new insights for investigating the molecular mechanisms of hypertensive LVH.

How does LAPTM5 affect neuronal survival during cerebral ischemia/reperfusion (I/R) injury?

LAPTM5 plays a protective role in cerebral I/R injury. Studies have demonstrated:

  • LAPTM5 expression dramatically decreases during cerebral I/R injury both in vivo and in vitro

  • LAPTM5 deficiency exacerbates neuronal damage after I/R injury by facilitating inflammation and promoting apoptosis

  • LAPTM5 knockout mice show increased macrophage/microglia infiltration in the brain after I/R injury, as evidenced by F4/80 staining

  • LAPTM5 deletion leads to upregulation of proinflammatory genes (Tnf, Il6, Ccl-2, and Ccl-5) following I/R injury

  • Increased activation of the inflammatory NF-κB pathway (phosphorylated IKKβ and p65) in LAPTM5-KO mice after I/R injury

  • LAPTM5 deletion promotes neuronal apoptosis, with increased TUNEL-positive neurons and upregulation of pro-apoptotic genes (Bax, Bad, and Fas)

Conversely, LAPTM5 overexpression in neurons:

  • Increases neuronal viability following OGD/R treatment

  • Downregulates pro-inflammatory genes (Tnf, Ccl-2, and Ccl-5)

  • Diminishes pro-apoptotic molecules (Bax, Cleaved-caspase3, and Fas) while elevating anti-apoptotic factor (Bcl2) expression

What are the optimal approaches for manipulating LAPTM5 expression in experimental systems?

Several effective approaches have been developed for manipulating LAPTM5 expression:

For LAPTM5 overexpression:

  • Adenoviral vectors (Ad-LAPTM5) have proven effective for overexpression in primary neurons and hepatocytes

  • Transfection efficiency of 100 MOI (multiplicity of infection) for 48 hours before experimental treatments provides optimal expression

  • Verification of overexpression can be conducted via western blot and functional assays

For LAPTM5 knockdown/knockout:

  • shRNA-mediated knockdown using hairpin-forming oligonucleotides cloned into appropriate vectors (e.g., pENTR-U6-CMV-GFP shuttle vector)

  • CRISPR/Cas9-mediated gene editing for complete knockout models

  • Conditional knockout systems for tissue-specific deletion

Verification methods:

  • Western blot analysis for protein expression

  • RT-qPCR for mRNA levels

  • Immunofluorescence staining for cellular localization

  • Functional assays specific to the tissue/cell type being studied

What analytical techniques are most effective for studying LAPTM5-mediated protein interactions?

The following techniques have proven effective for studying LAPTM5 protein interactions:

  • Co-immunoprecipitation (Co-IP): Effectively demonstrates LAPTM5 binding to partner proteins such as ASK1 . This technique revealed that LAPTM5 could bind to ASK1 while showing minimal binding to TAK1 in transfected 293T cells .

  • Protein-protein interaction (PPI) network analysis: Construction of PPI networks has revealed LAPTM5's interactions with key regulatory proteins including AKT1, CASP3, PTEN, BECN1, FOXO3, MTOR, and others .

  • Western blotting: Critical for detecting changes in target protein levels and post-translational modifications after LAPTM5 manipulation .

  • Lysosomal sorting assays: Used to track the fate of interacting proteins and determine how LAPTM5 affects their lysosomal degradation .

  • Ubiquitination assays: Helpful for determining how LAPTM5 affects the ubiquitination status of interacting proteins .

What functional assays best measure the impact of LAPTM5 manipulation on cellular processes?

Several functional assays have successfully measured LAPTM5's impact on cellular processes:

  • Cell viability assays:

    • CCK-8 (Cell Counting Kit-8) assay effectively measures neuronal viability following OGD/R treatment and LAPTM5 manipulation

  • Inflammation assessment:

    • RT-qPCR for inflammatory gene expression (Tnf, Il6, Ccl-2, Ccl-5)

    • Western blot for inflammatory signaling pathways (p-IKKβ, p-p65, IκBα)

    • Immunostaining for inflammatory markers (F4/80, p-p65)

  • Apoptosis detection:

    • TUNEL staining co-localized with neuronal markers (NeuN)

    • RT-qPCR for apoptotic gene expression (Bcl2, Bax, Bad, Fas)

    • Western blot for apoptotic protein markers (Bcl2, Bax, Cleaved-caspase 3)

  • Pathway analysis:

    • RNA-seq followed by Gene Set Enrichment Analysis (GSEA)

    • Hierarchical clustering analysis

    • Western blot for signaling pathway components (JNK, p38, ERK, ASK1)

How can researchers accurately quantify LAPTM5 expression across different sample types?

Accurate quantification of LAPTM5 expression can be achieved through:

  • Protein level quantification:

    • Western blot with appropriate normalization to housekeeping proteins

    • ELISA (Enzyme-Linked Immunosorbent Assay) for serum/plasma samples

    • Immunohistochemistry with digital image analysis for tissue sections, which has successfully been used to correlate LAPTM5 levels with NAS scores in NASH patients

  • mRNA level quantification:

    • RT-qPCR with appropriate reference genes

    • RNA-seq with normalized read counts

    • In situ hybridization for tissue localization

  • Important considerations:

    • Post-transcriptional regulation may result in discrepancies between mRNA and protein levels of LAPTM5, as observed in NASH studies

    • Tissue-specific reference genes should be selected for accurate normalization

    • Validation across multiple quantification methods is recommended for robust results

How do researchers reconcile the seemingly contradictory roles of LAPTM5 across different disease contexts?

LAPTM5 exhibits context-dependent functions that may appear contradictory:

  • Protective roles:

    • In NASH, LAPTM5 protects against steatohepatitis and its metabolic complications

    • In cerebral I/R injury, LAPTM5 protects against neuronal damage, inflammation, and apoptosis

  • Pathological roles:

    • In renal cancer, LAPTM5 promotes lung-specific metastasis

    • In hypertensive LVH, elevated LAPTM5 correlates with disease markers

Reconciliation approaches:

  • Tissue-specific analysis: LAPTM5 may interact with different protein partners depending on the cellular context, leading to divergent outcomes.

  • Pathway-focused investigation: Examine how LAPTM5 affects specific signaling pathways (NF-κB, MAPK, BMP) differently across tissues.

  • Protein interaction network mapping: Comprehensive protein-protein interaction studies in different tissues can reveal context-specific binding partners.

  • Temporal considerations: LAPTM5's effects may vary depending on the stage of disease progression.

  • Post-translational modifications: Different modifications of LAPTM5 may account for its diverse functions.

What are the most promising therapeutic strategies targeting LAPTM5 for disease treatment?

Based on current research, several therapeutic strategies show promise:

  • For conditions where LAPTM5 is protective (NASH, cerebral I/R injury):

    • Adenoviral-mediated LAPTM5 overexpression has shown efficacy in experimental models

    • Compounds that stabilize LAPTM5 or prevent its degradation

    • Targeting upstream regulators of LAPTM5 expression

  • For conditions where LAPTM5 is pathological (cancer metastasis):

    • Lysosomal inhibitors like chloroquine can restore expression of LAPTM5-degraded targets (e.g., BMPR1A)

    • Small molecule inhibitors of LAPTM5-protein interactions

    • RNA interference approaches to reduce LAPTM5 expression

  • Considerations for therapeutic development:

    • Tissue-specific delivery systems to avoid unintended effects

    • Careful monitoring of potential side effects due to LAPTM5's diverse functions

    • Combination therapies targeting multiple aspects of LAPTM5-related pathways

What molecular mechanisms account for the differential regulation of LAPTM5 expression in various pathological conditions?

Several mechanisms potentially explain the differential regulation of LAPTM5:

  • Transcriptional regulation:

    • Tissue-specific transcription factors

    • Disease-related transcriptional repressors or activators

    • Epigenetic modifications of the LAPTM5 promoter region

  • Post-transcriptional regulation:

    • In NASH, LAPTM5 protein levels decrease while mRNA levels remain unchanged or increase, suggesting significant post-transcriptional regulation

    • MicroRNA-mediated regulation

    • RNA binding proteins affecting transcript stability

  • Post-translational regulation:

    • Ubiquitination and proteasomal degradation

    • Phosphorylation affecting protein stability

    • Glycosylation impacting protein trafficking and function

  • Environmental factors:

    • Palmitic acid treatment leads to decreased LAPTM5 protein expression in hepatocytes

    • Ischemic conditions reduce LAPTM5 expression in neurons

    • Tissue microenvironment influences on LAPTM5 stability

Understanding these regulatory mechanisms could provide new avenues for therapeutic intervention in LAPTM5-related disorders.

How does LAPTM5 interact with autophagy pathways across different cell types?

LAPTM5 interacts with autophagy pathways in several ways:

  • Connection to lysosomal function:

    • As a lysosomal transmembrane protein, LAPTM5 is positioned to influence lysosomal-dependent autophagy processes

    • LAPTM5 promotes lysosomal degradation of specific proteins like CDC42 in hepatocytes

  • Interaction with autophagy-related proteins:

    • LAPTM5-mediated protein-protein interaction networks reveal connections with autophagy regulators including BECN1, ATG12, PINK1, ULK1, and SQSTM1

    • These interactions suggest LAPTM5 may directly modulate autophagy machinery

  • Correlation with autophagy markers:

    • LAPTM5 shows strong correlations with diverse marker sets of autophagy in hypertensive LVH models

    • This suggests coordinated regulation or functional interaction between LAPTM5 and autophagy processes

  • Potential therapeutic implications:

    • Modulating LAPTM5 expression may affect autophagic flux

    • Combined targeting of LAPTM5 and autophagy pathways could provide synergistic therapeutic effects

What are the key unanswered questions regarding LAPTM5 structure-function relationships?

Several critical questions remain unanswered regarding LAPTM5 structure-function:

  • Structural determinants of protein interactions:

    • Which domains of LAPTM5 mediate specific protein interactions (e.g., with CDC42, ASK1, WWP2)?

    • How do post-translational modifications alter these interaction interfaces?

  • Membrane topology and functional significance:

    • How does the transmembrane organization of LAPTM5 contribute to its function?

    • Are there critical residues within the transmembrane domains that determine specificity?

  • Structural basis for lysosomal targeting:

    • What structural elements ensure proper localization of LAPTM5 to lysosomes?

    • How does this localization influence its function in protein degradation?

  • Conformational changes during function:

    • Does LAPTM5 undergo conformational changes when binding partner proteins?

    • How might these changes influence downstream signaling events?

What techniques are emerging for studying LAPTM5 dynamics in real-time within living cells?

Emerging techniques for studying LAPTM5 dynamics include:

  • Advanced imaging approaches:

    • Live-cell imaging with fluorescently tagged LAPTM5

    • Super-resolution microscopy to visualize LAPTM5 localization at the nanoscale

    • FRET (Förster Resonance Energy Transfer) to study LAPTM5-protein interactions in real-time

  • Proximity labeling techniques:

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to LAPTM5 in living cells

    • These approaches could reveal transient or weak interactions missed by traditional co-IP

  • Optogenetic tools:

    • Light-inducible LAPTM5 expression or degradation systems

    • Optogenetic control of LAPTM5 interactions with partner proteins

  • Single-molecule tracking:

    • Monitoring individual LAPTM5 molecules to understand trafficking and dynamic behavior

    • Correlation with lysosomal movements and function

How might species differences in LAPTM5 impact translational research from animal models to humans?

Species differences in LAPTM5 could significantly impact translational research:

  • Sequence and structural variations:

    • Differences in primary sequence between bovine, murine, and human LAPTM5

    • Potential variations in post-translational modification sites

    • Structural differences affecting protein-protein interactions

  • Expression pattern differences:

    • Tissue-specific expression profiles may vary between species

    • Developmental regulation might differ, affecting model selection

  • Functional divergence:

    • Partner proteins may show species-specific interactions

    • Signaling pathway connections could vary between species

  • Translational considerations:

    • Validation of findings across multiple species before clinical translation

    • Humanized animal models might provide more relevant insights

    • Careful interpretation of results from bovine or murine studies when applying to human disease

Understanding these species differences is crucial for developing effective LAPTM5-targeted therapies that successfully translate from preclinical models to human patients.

What are the most frequent technical difficulties in LAPTM5 detection and how can they be overcome?

Common technical difficulties and solutions include:

  • Antibody specificity issues:

    • Problem: Non-specific binding or weak signals in western blots and immunostaining

    • Solutions:

      • Validate antibodies using positive and negative controls (LAPTM5 overexpression and knockout samples)

      • Use multiple antibodies targeting different epitopes

      • Optimize blocking conditions to reduce background

  • Low endogenous expression:

    • Problem: Difficulty detecting native LAPTM5 in certain tissues

    • Solutions:

      • Use more sensitive detection methods (chemiluminescence, fluorescence)

      • Enrich lysosomal fractions before analysis

      • Consider signal amplification techniques

  • Protein degradation during extraction:

    • Problem: Loss of LAPTM5 signal during sample preparation

    • Solutions:

      • Use protease inhibitors throughout extraction

      • Maintain cold temperatures during processing

      • Consider specialized extraction buffers for membrane proteins

  • Cross-reactivity with related proteins:

    • Problem: False signals from related lysosomal proteins

    • Solutions:

      • Use highly specific monoclonal antibodies

      • Confirm results with genetic approaches (siRNA, CRISPR)

      • Include appropriate controls in all experiments

How can researchers optimize cell and tissue preparation for LAPTM5 research?

Optimal preparation approaches include:

  • For tissue samples:

    • Rapid freezing or fixation immediately after collection to preserve protein integrity

    • Careful sectioning techniques to maintain cellular architecture

    • Antigen retrieval optimization for immunohistochemistry

    • Specialized extraction buffers for membrane proteins when preparing lysates

  • For cultured cells:

    • Consistent cell culture conditions to minimize variability

    • Optimal cell density for experiments (typically 70-80% confluence)

    • Synchronized cell populations when studying dynamic processes

    • Careful trypsinization to avoid damage to membrane proteins

  • For subcellular fractionation:

    • Gentle lysis conditions to preserve lysosomal integrity

    • Differential centrifugation protocols optimized for lysosomal enrichment

    • Verification of fraction purity using lysosomal markers

    • Immediate processing to prevent degradation

  • For protein interaction studies:

    • Cross-linking to capture transient interactions

    • Detergent selection appropriate for membrane protein solubilization

    • Buffer optimization to maintain physiological interactions

    • Inclusion of phosphatase inhibitors to preserve modification states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.