Recombinant Bovine Melanocortin receptor 4 (MC4R)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions and Signaling Pathways

MC4R mediates signaling through two primary pathways:

  1. Gαs-cAMP signaling: Activates adenylyl cyclase, increasing intracellular cAMP levels .

  2. β-Arrestin recruitment: Triggers mitogen-activated protein kinase (MAPK) pathways, influencing metabolic adaptation .

Table 2: Biochemical Functions of MC4R

FunctionMechanismReference
Energy HomeostasisRegulates food intake via hypothalamic signaling
Glucose RegulationModulates insulin secretion and hepatic gluconeogenesis
Anti-Inflammatory RoleInhibits cytokine production in astrocytes

Involvement in Pathways

MC4R interacts with pathways critical for metabolic and neuroendocrine processes:

Table 3: Key Pathways Involving MC4R

PathwayRole of MC4RRelated Proteins
Neuroactive Ligand-Receptor InteractionMediates α-MSH/AGRP signalingSSTR4, ADRB2B, GRM6
cAMP SignalingCouples to Gαs, activating adenylyl cyclaseAC, PKA
MAPK/ERK Signalingβ-Arrestin-dependent activation of ERK1/2ERK1/2, β-Arrestin-2

Research Applications and Functional Studies

Recombinant bovine MC4R is utilized in:

  • Drug Discovery: Screening agonists (e.g., setmelanotide, THIQ) for obesity treatment .

  • Mutagenesis Studies: Identifying residues critical for ligand binding (e.g., I129 3.32, R147 3.50) .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve active/inactive conformations .

Key Findings from Functional Studies:

  • Signaling Bias: Gain-of-function (GoF) variants (e.g., V103I) preferentially recruit β-arrestin, enhancing metabolic benefits .

  • Pharmacological Chaperones: Small molecules may rescue trafficking-defective mutants, offering therapeutic potential .

Limitations and Future Directions

  • Species-Specific Data: Most studies focus on human/rodent MC4R; bovine-specific functional data are sparse.

  • Therapeutic Challenges: Off-target effects (e.g., skin pigmentation via MC1R) limit universal MC4R agonist use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form maintains its quality for 6 months at -20°C/-80°C. Lyophilized form exhibits a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MC4R; Melanocortin receptor 4; MC4-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNSTQPLGMHTSLHSWNRSAHGMPTNVSESLAKGYSDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVD IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVAITISAIWAACTVS GVLFIIYSDSSAVIICLITVFFTMLALMASLYVHMFLMARLHIKRIAVLPGSGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCSPLGGLCDLSSRY
Uniprot No.

Target Background

Function
Melanocortin receptor 4 (MC4R) is a receptor specific for the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. It plays a crucial role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Gene References Into Functions

Gene References & Function

  1. Evaluates the association of single nucleotide polymorphisms (SNPs) in MC4R with milk production traits in water buffalo. Based on the SNP data, seven haplotypes were constructed. Three SNPs, H1 (AGT), H2 (GAT), and H3 (GAC), accounted for 93.0% of the total individuals. Statistical analysis indicated that the SNP g.1104C>T was significantly associated with milk yield, protein, and fat percentage. PMID: 27420995
  2. Suggests that the MC4R gene may be a candidate gene for carcass traits with MC4R single nucleotide polymorphisms being potentially valuable as genetic markers for economic traits in Hanwoo. PMID: 21735104
  3. Aims to estimate the frequency of the SNPs in the MC4R gene and to determine if individual genotypes were associated with several economic traits. PMID: 20563647
  4. Indicates that the -129A>G and 1,069C>G single nucleotide polymorphism of the MC4R gene may be useful as a genetic marker for carcass and meat quality traits in Qinchuan cattle. PMID: 19714485
  5. Suggests that adrenal glucocorticoid production could be regulated through melanocortin 4 receptor PMID: 14592963
  6. Detects single nucleotide polymorphisms in the 5'-untranslated region of the MC4R gene. PMID: 18987992

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Melanocortin 4 Receptor and what are its primary functions in bovine physiology?

The Melanocortin 4 Receptor (MC4R) is a G protein-coupled receptor (GPCR) belonging to the melanocortin receptor family, which consists of five receptor subtypes (MC1R to MC5R). In bovines, as in other mammals, MC4R is highly expressed in the paraventricular nucleus of the hypothalamus and plays crucial roles in:

  • Regulating energy homeostasis and food intake

  • Controlling metabolism and body weight

  • Influencing fat deposition in muscle tissues

  • Potentially affecting reproductive and sexual functions

MC4R acts as a key switch in the leptin-melanocortin molecular axis that controls hunger and satiety by binding endogenous hormones such as α-melanocyte-stimulating hormone (α-MSH) . Variants in the bovine MC4R gene have been associated with differences in carcass fat composition and lean meat yield, suggesting its importance in regulating energy partitioning in cattle .

How does bovine MC4R structure compare to human MC4R?

Bovine MC4R, like human MC4R, belongs to the rhodopsin-like class A peptide GPCR family with seven transmembrane domains (TMs) connected by alternating extracellular loops (ELs) and intracellular loops (ICLs). Both share several distinctive structural features:

  • The N-terminus is extracellular, and the C-terminus is intracellular

  • The MC4R lacks the highly conserved disulfide bond linking the top of TM3 and EL2 that is found in many other family A GPCRs

  • Both have relatively short intracellular and extracellular loops, particularly EL2

  • Conserved Pro in TM5 and Asn in TM7 (in the NPxxY motif) are substituted by Met and Asp, respectively

What significant polymorphisms have been identified in bovine MC4R and what are their phenotypic effects?

Research has identified a novel Ser330Asn polymorphism in the bovine MC4R gene with significant phenotypic effects on carcass composition. The key findings include:

PopulationMinor Allele FrequencyPhenotypic Effects in HeterozygotesStatistical Significance
Canadian Steers0.01Increased grade fatP = 0.036
Canadian Steers0.01Decreased lean meat yieldP = 0.032
American Steers0.02Increased backfatP = 0.031
American Steers0.02Less desirable yield gradesP = 0.022
American Steers0.02Lower longissimus dorsi measurementsP = 0.031

This polymorphism has been validated in two distinct crossbred steer populations, suggesting it has effects of commercial significance across different genetic backgrounds . The association of the Asn330 allele with increased fat deposition parallels findings in other species where MC4R variants affect energy homeostasis and metabolism.

What are the recommended methodologies for genotyping MC4R polymorphisms in bovine samples?

For reliable genotyping of MC4R polymorphisms in bovine samples, researchers should consider the following methodological approach:

  • PCR Amplification: Use the primers MC4R Gen Forward (5'-GCAAAGACCTGCATGCCTCCGACT-3') and MC4R End Reverse (5'-CTGTCTCTGAGAAACACACATAGT-3') designed from existing bovine MC4R sequences to amplify an 1845 bp product covering the entire gene .

  • PCR Protocol:

    • Standard PCR reaction mixture: 10× PCR buffer, 10 mM dNTPs, 10 pm/μL primers, 0.5 U Taq polymerase, and 50-100 ng extracted DNA

    • Cycling conditions: Initial denaturation at 94°C for 4 min, followed by 38 cycles of (94°C for 50 s, 60°C for 50 s, 72°C for 50 s), and final extension at 72°C for 4 min

  • For Ser330Asn Polymorphism Detection:

    • Use primers MC4R 3'UTR F (5'-GACCCTCTGATTTATGCCCTG-3') and MC4R 3'UTR R (5'-GCTGTGGCTGATACAGACTGT-3') to amplify a 195 bp product

    • Digest with restriction enzyme Fspb1 to distinguish alleles:

      • g.989A allele: Fragments of 73 and 122 bp

      • g.989G allele: Fragments of 22, 73, and 100 bp

  • Full Sequence Analysis: For comprehensive polymorphism detection, gel extraction and purification of the PCR product followed by direct sequencing is recommended.

What expression systems are most effective for producing functional recombinant bovine MC4R?

Based on research with human MC4R that can inform bovine MC4R expression strategies, several expression systems have proven effective:

Expression SystemAdvantagesDisadvantagesBest Applications
HEK293 CellsNative-like post-translational modifications; Proper protein folding; Suitable for functional studiesLower yield; More expensive; Labor-intensiveReceptor binding assays; Signaling studies; Structure-function analysis
Viral-Like Particles (VLPs)Presents receptor in native membrane environment; Good for antibody productionComplex production process; Variable yieldImmunization; Phage display; Antibody screening
E. coliHigh yield; Cost-effective; Rapid productionLimited post-translational modifications; Refolding often requiredProduction of receptor fragments; Periplasmic expression of antibody fragments
Llama ImmunizationGeneration of conformationally-selective nanobodies; Access to single domain antibodiesRequires animal facilities; Long production timelineDevelopment of conformation-specific binders; Generation of stabilizing nanobodies

For functional studies, mammalian expression systems like HEK293T cells transiently expressing SNAP-tagged MC4R constructs have been successfully used to characterize receptor activity . For structural studies, fusion constructs incorporating stabilizing elements such as a ConfoBody (Cb) to the C-terminus of a MC4R-β2AR hybrid GPCR have proven effective .

What methodological approaches are recommended for validating the functionality of recombinant bovine MC4R?

To ensure that recombinant bovine MC4R retains its native functionality, multiple complementary validation approaches should be implemented:

  • Ligand Binding Assays:

    • Homogeneous Time Resolved Fluorescence (HTRF) to evaluate binding of known ligands

    • Competition binding assays using labeled α-MSH and unlabeled competitors to determine binding affinities (Ki values)

  • Conformational Change Assessment:

    • ConfoSensor assays to monitor ligand-induced recruitment of G-protein mimetic molecules (such as Cb80)

    • FRET-based approaches to detect structural rearrangements upon ligand binding

  • Signaling Pathway Activation:

    • cAMP accumulation assays (e.g., Lance Ultra HTRF) to measure Gs-protein coupled signaling

    • Testing with benchmark agonists such as α-MSH or setmelanotide to confirm appropriate activation

  • Receptor Specificity Evaluation:

    • Testing binding and activation across multiple melanocortin receptor subtypes (MC1R-MC5R)

    • Using sequence-diverse panels of ligands to establish receptor selectivity profiles

How can researchers assess MC4R-specific signaling pathways and biased agonism?

To comprehensively characterize MC4R signaling pathways and potential biased agonism, researchers should implement a multi-faceted approach:

  • G Protein Signaling Assessment:

    • Measure cAMP accumulation using HTRF-based assays to quantify canonical Gs signaling

    • Utilize nanoluciferase complementation assays to directly measure mini-Gs recruitment with reduced signal amplification for more precise potency determination

  • β-Arrestin Recruitment Analysis:

    • Implement bioluminescence resonance energy transfer (BRET) or nanoluciferase complementation assays to quantify β-arrestin-2 recruitment

    • Compare efficacy and potency ratios between G protein and β-arrestin pathways to identify biased signaling

  • Comparative Ligand Profiling:

    • Testing multiple ligands in parallel across different signaling readouts

    • Novel MC4R agonists like protegrin-4-like-peptide-1 (Pr4LP1) and arenicin-1-like-peptide-1 (Ar3LP1) have shown distinct signaling profiles with higher efficacy (~2-fold) and potency (~20-fold) for β-arrestin-2 recruitment compared to endogenous α-MSH

  • Pathway-Specific Controls:

    • Include known balanced and biased ligands as reference compounds

    • Utilize pathway-selective inhibitors to validate signaling specificity

What structural approaches are being used to study MC4R activation mechanisms?

Recent advances in structural biology have provided valuable insights into MC4R activation mechanisms that can inform bovine MC4R research:

  • Active State Stabilization Strategies:

    • Generation of MC4R-β2AR chimeric constructs where the C-terminus and intracellular loops of β2AR are grafted onto MC4R

    • Fusion with conformation-selective nanobody-based binding domains (ConfoBody Cb80) to stabilize active receptor states

  • Cryo-Electron Microscopy:

    • Using active state-stabilized MC4R complexes to solve structures at high resolution (e.g., 3.4 Å)

    • Co-crystallization with full agonistic nanobodies like pN162 to capture active conformations

  • Nanobody Development for Structural Studies:

    • Immunization of llamas with engineered active state MC4R conformations

    • Phage display screening on virus-like particles (VLPs) presenting active state-stabilized MC4R

    • Selection based on MC4R specificity and signaling capability

  • Computational Modeling:

    • Molecular dynamics simulations to explore conformational changes during receptor activation

    • Docking studies to predict ligand binding modes and identify key interaction residues

How can MC4R research be applied to improve cattle breeding programs?

MC4R polymorphism research offers several promising applications for cattle breeding programs:

  • Marker-Assisted Selection:

    • Integration of MC4R genotyping in selection programs to predict carcass composition traits

    • Potentially helpful for sorting crossbred cattle in customized feeding programs to optimize carcass quality

  • Precision Feeding Strategies:

    • Development of genotype-specific feeding regimens to optimize economic outcomes

    • Tailoring finishing periods based on MC4R genotype to achieve desired fat deposition and meat quality

  • Cross-Breeding Optimization:

    • Strategic breeding to balance favorable MC4R alleles with other desirable production traits

    • Management of the Ser330Asn polymorphism frequency to achieve target phenotypic distributions

  • Economic Analysis:

    • Implementation of MC4R genotyping could provide significant value through improved carcass quality

    • The validation of the Asn330 allele effects in two distinct populations (Canadian and American) strengthens the case for commercial application

What methodological considerations should be addressed when designing MC4R association studies in cattle populations?

When designing MC4R association studies in cattle populations, researchers should consider:

  • Population Structure Assessment:

    • Account for breed composition, particularly Bos indicus influence

    • Document management and treatment factors (e.g., use of growth promoters like Zilpaterol hydrochloride)

  • Comprehensive Phenotyping:

    • Collect detailed carcass measurements including grade fat, lean meat yield, backfat, yield grades, and longissimus dorsi measurements

    • Standardize measurement protocols across evaluation sites

  • Statistical Analysis Approach:

    • Account for potential confounding factors such as breed, age, sex, and management

    • Consider appropriate significance thresholds and correction for multiple testing

    • Validate findings across independent populations

  • Sample Size Determination:

    • Plan for adequate statistical power, particularly given the low minor allele frequency (0.01-0.02)

    • Canadian study utilized 382 crossbred steers while American study examined 985 animals, providing sufficient power to detect associations

What strategies are being employed to develop selective MC4R agonists for research applications?

Several innovative approaches are being utilized to develop selective MC4R agonists:

  • Peptide Scaffold Exploitation:

    • Molecular grafting of pharmacophore peptide sequence motifs onto stable nature-derived peptide scaffolds

    • Utilization of disulfide-rich scaffolds from animal sources (e.g., protegrin-4-like-peptide-1 and arenicin-1-like-peptide-1)

  • Structure-Function Optimization:

    • Leveraging recent structural data on active state MC4R conformations

    • Rational design based on the binding pocket characteristics of MC4R versus other melanocortin receptor subtypes

  • Subtype Selectivity Screening:

    • Comprehensive testing against related receptors (MC1R, MC3R) to identify selective compounds

    • Novel peptides like Pr4LP1 and Ar3LP1 have demonstrated MC4R selectivity with no activity at MC1R and MC3R in cAMP accumulation assays

  • Signaling Profile Characterization:

    • Evaluation of G-protein versus β-arrestin pathways to identify compounds with desired signaling bias

    • Some designed peptides have shown enhanced β-arrestin-2 recruitment compared to endogenous α-MSH

How can bovine MC4R research inform the development of human MC4R-targeted therapeutics?

Bovine MC4R research provides valuable insights that can translate to human therapeutic development:

  • Comparative Receptor Analysis:

    • Identification of conserved and divergent features between bovine and human MC4R

    • Understanding species-specific ligand interactions that may inform selective drug design

  • Polymorphism-Function Relationships:

    • Natural bovine MC4R variants like Ser330Asn that affect metabolism can provide insights into structure-function relationships

    • Potential parallels with human MC4R variants associated with obesity

  • Agricultural Application Learnings:

    • Observations about MC4R effects on body composition in cattle may inform approaches to human metabolic disorders

    • Translating phenotypic findings across species to predict therapeutic outcomes

  • Novel Binding Domain Identification:

    • Discovery of receptor regions that could be targeted for subtype-selective binding

    • Exploitation of conformational differences that might be conserved across species

What are common challenges in recombinant bovine MC4R research and how can they be addressed?

Researchers working with recombinant bovine MC4R frequently encounter several challenges that can be addressed through specific methodological approaches:

  • Low Expression Levels:

    • Optimize codon usage for the expression system

    • Use strong, tissue-specific promoters

    • Consider fusion tags that enhance expression (e.g., SNAP-tag)

    • Implement inducible expression systems to reduce potential toxicity

  • Conformational Heterogeneity:

    • Develop stabilized constructs through chimeric approaches (e.g., MC4R-β2AR hybrids)

    • Utilize conformation-selective binding partners like nanobodies (Cb80)

    • Screen multiple detergents and lipid compositions for optimal stability

  • Receptor Specificity Verification:

    • Comprehensive testing against all five melanocortin receptor subtypes

    • Develop and validate MC4R knockout controls

    • Use multiple functional readouts to confirm specificity

  • Signaling Assay Sensitivity:

    • Implement assays with different levels of signal amplification (e.g., direct mini-Gs recruitment versus cAMP accumulation)

    • Include appropriate positive controls (e.g., setmelanotide)

    • Optimize cell density and receptor expression levels for optimal signal-to-noise ratio

What experimental design considerations are critical for studying MC4R signaling in bovine systems?

When designing experiments to study MC4R signaling in bovine systems, researchers should consider:

  • Cell System Selection:

    • Native bovine cells versus heterologous expression systems

    • Consideration of endogenous signaling components that may differ between species

    • Potential for establishing bovine-derived stable cell lines expressing MC4R

  • Standardization of Expression Levels:

    • Quantification of receptor expression using techniques like radioligand binding or fluorescent labeling

    • Implementation of inducible expression systems to control receptor density

    • Correlation of expression levels with functional responses

  • Comprehensive Signaling Pathway Analysis:

    • Parallel measurement of G protein (cAMP) and β-arrestin recruitment pathways

    • Investigation of potential non-canonical signaling routes

    • Analysis of signaling kinetics and not just endpoint measurements

  • Genetic Background Considerations:

    • Account for breed-specific differences when working with primary bovine cells

    • Document the origin and characteristics of samples used in polymorphism studies

    • Consider creating isogenic cell lines differing only in MC4R genotype for controlled comparisons

What emerging technologies could advance bovine MC4R research?

Several cutting-edge technologies hold promise for advancing bovine MC4R research:

  • CRISPR/Cas9 Gene Editing:

    • Generation of bovine cell lines with specific MC4R variants

    • Development of MC4R knockout models to study loss-of-function phenotypes

    • Introduction of reporter tags at endogenous loci for native expression level studies

  • Single-Cell Technology Applications:

    • Single-cell RNA sequencing to map MC4R expression across tissues and cell types

    • Single-cell proteomics to identify cell type-specific signaling partners

    • Spatial transcriptomics to visualize MC4R expression patterns in hypothalamic and other tissues

  • Advanced Structural Biology Methods:

    • Application of cryo-electron microscopy to bovine MC4R complexes

    • Hydrogen-deuterium exchange mass spectrometry to map ligand-induced conformational changes

    • Molecular dynamics simulations based on species-specific structures

  • High-Throughput Functional Screening:

    • Development of biosensor systems for real-time monitoring of MC4R activation

    • Automated patch-clamp systems to study potential electrophysiological effects

    • Multiplexed signaling assays to simultaneously measure multiple pathway activities

How might integrated multi-omics approaches enhance our understanding of bovine MC4R biology?

Integrated multi-omics approaches offer powerful strategies for comprehensive understanding of bovine MC4R biology:

  • Genomics-Proteomics Integration:

    • Correlation of MC4R polymorphisms with proteomic profiles in relevant tissues

    • Identification of potential modifier genes affecting MC4R function

    • Characterization of post-translational modifications affecting receptor activity

  • Metabolomics Applications:

    • Profiling metabolic changes associated with different MC4R genotypes

    • Identification of downstream metabolic pathways affected by MC4R signaling

    • Discovery of potential biomarkers for MC4R activity in bovine systems

  • Systems Biology Modeling:

    • Development of computational models integrating MC4R signaling with whole-body energy metabolism

    • Prediction of phenotypic outcomes based on MC4R genotype and environmental factors

    • Simulation of interventions to optimize desired traits in cattle breeding

  • Comparative Species Analyses:

    • Cross-species comparison of MC4R structure, function, and regulatory networks

    • Evolutionary analysis to identify conserved functional domains

    • Translational implications between bovine research and human health applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.