Recombinant Bovine Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Commercial platforms utilize multiple expression systems to optimize yield and functionality:

  • E. coli: Cost-effective for large-scale production but lacks glycosylation .

  • Mammalian cells: Preserves native-like post-translational modifications .

  • Baculovirus/insect cells: Balances yield and moderate glycosylation .

Quality control metrics include:

  • Purity: ≥85% verified by SDS-PAGE .

  • Activity: Validated via cAMP response assays upon α-MSH binding .

  • Specificity: ELISA kits confirm recognition of native bovine MC1R in tissue homogenates .

Functional Roles

Recombinant bovine MC1R retains biological activities critical for melanogenesis regulation:

  • Ligand binding: Activates upon binding α-MSH or ACTH, triggering cAMP signaling .

  • Pigment switching: Promotes eumelanin synthesis over pheomelanin via MITF transcription factor activation .

  • UV response modulation: Enhances DNA repair mechanisms in melanocytes .

Table: Functional Interactions

Interaction PartnerBiological EffectSource
α-MSHIncreases cAMP (EC₅₀ = 0.2–1.0 nM)
ASIP (Agouti)Competitive inverse agonism
Gαs proteinAdenylate cyclase activation

Genetic Variant Analysis

Two novel bovine MC1R alleles (ev1: p.Arg142Cys; ev2: p.Ser88Asn) identified in Alpine cattle breeds alter receptor function, causing recessive red coat phenotypes . Recombinant protein studies confirmed these variants reduce cAMP signaling by 60–80% compared to wild-type .

Therapeutic Development

  • Melanoma research: MC1R loss-of-function variants correlate with UV sensitivity and skin cancer risk .

  • Drug screening: Used to identify small-molecule agonists/antagonists targeting pigmentation disorders .

Biochemical Assays

  • ELISA: Quantifies native MC1R in bovine tissues (detection range: 0.312–20 ng/mL) .

  • Surface plasmon resonance: Measures binding kinetics for α-MSH (K<sub>D</sub> = 3.1 nM) .

Challenges and Future Directions

While recombinant bovine MC1R is indispensable for pigment biology studies, limitations persist:

  • Glycosylation discrepancies: Mammalian-expressed variants show higher functional fidelity than prokaryotic systems .

  • Constitutive activity: High basal signaling in vitro requires inverse agonists for accurate assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; BDF3; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MPALGSQRRLLGSLNCTPPATLPFTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGVLATQAAVVQQLDNVI DVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHKVILLCLVGLFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function

This receptor binds to α-MSH, β-MSH, and ACTH but shows no activity with γ-MSH. Its activity is mediated by G proteins that activate adenylate cyclase. MC1R regulates melanogenesis, the production of eumelanin (black/brown) and pheomelanin (red/yellow) pigments, by modulating cAMP signaling in melanocytes.

Database Links

STRING: 9913.ENSBTAP00000055607

UniGene: Bt.553

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the testis.

Q&A

What is the structure and function of bovine MC1R?

Bovine MC1R, like its human counterpart, is a G protein-coupled receptor (GPCR) with seven α-helical transmembrane (TM) domains. It consists of approximately 317 amino acids with key structural features including an N-linked glycosylation site at the external N-terminus, a palmitoylation site at the intracellular C-terminus, and a DRY motif at the junction of the third TM domain .

MC1R functions primarily in melanocytes to regulate pigmentation. When activated by α-melanocyte stimulating hormone (α-MSH), MC1R triggers intracellular cAMP production through adenylyl cyclase stimulation. This activates protein kinases C and A, leading to MAPK and JAK-STAT pathway activation . The signaling cascade ultimately regulates melanin production and the ratio of eumelanins (black/brown pigments) to pheomelanins (yellow/red pigments) .

Beyond pigmentation, MC1R exhibits anti-inflammatory properties through downstream pathways that prevent IκB degradation and activate CREB, a transcription factor regulating anti-inflammatory mediators. This inhibits expression of pro-inflammatory genes including IL-1, TNF-α, IL-6, and IL-8 .

What expression systems are most effective for producing recombinant bovine MC1R?

For recombinant bovine MC1R production, researchers should consider the following expression systems based on their experimental goals:

Mammalian expression systems (HEK293, CHO cells):

  • Most suitable for functional studies requiring proper post-translational modifications

  • Provide the most physiologically relevant cellular environment

  • Yield authentic glycosylation patterns essential for proper folding and trafficking

  • Enable evaluation of receptor activity in a near-native membrane environment

Insect cell expression systems (Sf9, Sf21):

  • Offer a good compromise between yield and post-translational modifications

  • Particularly effective for structural studies requiring larger protein quantities

  • Baculovirus infection protocols allow for scalable production

  • Support proper folding of complex membrane proteins like MC1R

Yeast expression systems (P. pastoris):

  • Higher yields than mammalian systems

  • Provide some post-translational modifications

  • Cost-effective for large-scale production

  • May have differences in glycosylation patterns compared to native MC1R

Expression yields vary significantly across systems, with typical functional MC1R expression densities ranging from 700 receptors/cell in native systems to significantly higher levels in recombinant systems optimized for overexpression .

For purification following expression, researchers typically employ affinity tags (His, FLAG) followed by detergent solubilization optimization to maintain receptor functionality .

How can receptor activity be validated for recombinant bovine MC1R?

Validating recombinant bovine MC1R activity requires multiple complementary approaches to confirm both expression and functionality:

Ligand binding assays:

  • Radioligand binding using [125I]-labeled α-MSH

  • Saturation binding experiments to determine Kd and Bmax values

  • Competition binding to evaluate ligand selectivity

  • These assays confirm the receptor's ability to recognize its cognate ligands

Functional signaling assays:

  • cAMP accumulation assays (primary MC1R signaling pathway)

  • Reporter gene assays using CRE-luciferase constructs

  • ERK phosphorylation assays (downstream signaling)

  • Ca2+ mobilization assays as a secondary readout

Surface expression evaluation:

  • Flow cytometry using MC1R-specific antibodies

  • Immunofluorescence microscopy to visualize membrane localization

  • Cell-surface biotinylation followed by Western blotting

Desensitization and internalization studies:

  • Phosphorylation assessment following agonist exposure

  • Receptor internalization rates using fluorescently tagged receptors

  • Comparison with known MC1R regulatory mechanisms mediated by GRK6

A comprehensive validation approach would include dose-response studies with α-MSH, demonstrating appropriate EC50 values consistent with the expected pharmacological profile of bovine MC1R. Researchers should ensure that recombinant bovine MC1R retains key regulatory properties, including desensitization mechanisms mediated by GRK phosphorylation at residues analogous to human Thr-308 and Ser-316 .

What are the critical motifs and domains in bovine MC1R essential for functionality?

Based on comparative analysis with human MC1R, several critical domains and motifs in bovine MC1R are essential for proper function:

N-terminal domain:

  • Contains N-linked glycosylation sites crucial for proper folding and trafficking

  • Serves as a signal anchor and contributes to ligand affinity

  • A conserved cysteine residue at the N-terminus/TM1 junction is essential for receptor function

Transmembrane domains (TMs):

  • Form the ligand-binding pocket, particularly involving TM2, TM3, TM6, and TM7

  • Undergo conformational changes during receptor activation

  • Contain conserved residues that interact directly with melanocortin peptides

DRY motif:

  • Located at the junction of the third TM domain and second intracellular loop

  • Critical for G protein coupling and signal transduction

  • Highly conserved across species and essential for functional integrity

Intracellular loops (ILs):

  • Mediate interactions with G proteins, particularly Gs for MC1R

  • Contain phosphorylation sites for receptor regulation

  • IL3 is particularly important for G protein selectivity

C-terminal domain:

  • Contains palmitoylation sites essential for membrane anchoring

  • Houses phosphorylation sites (equivalent to human Thr-308 and Ser-316) targeted by GRK6

  • These phosphorylation sites regulate receptor desensitization and internalization

Mutation studies in human MC1R have identified key residues associated with altered receptor function, including R151C, R160W, and D294H. These variants show less efficient desensitization, and D294H demonstrates resistance to internalization, resulting in abnormally high surface expression . Equivalent positions in bovine MC1R would likely demonstrate similar functional significance.

How do post-translational modifications affect recombinant bovine MC1R function?

Post-translational modifications (PTMs) significantly impact recombinant bovine MC1R function and must be considered in experimental design:

N-linked glycosylation:

  • Essential for proper folding and trafficking to the plasma membrane

  • Influences ligand binding affinity and receptor stability

  • Expression systems lacking appropriate glycosylation machinery may produce non-functional or partially functional receptors

Palmitoylation:

  • Occurs at cysteine residues in the C-terminal domain

  • Critical for plasma membrane localization and lateral mobility

  • Affects interaction with G proteins and other signaling partners

  • Can be disrupted in some expression systems, particularly prokaryotic ones

Phosphorylation:

  • Key regulatory mechanism for receptor desensitization

  • Mediated by GRK6 at specific C-terminal residues (analogous to human Thr-308 and Ser-316)

  • Different expression systems may have varying levels of GRKs, affecting receptor regulation

  • Phosphorylation state influences receptor internalization and recycling

Ubiquitination:

  • Regulates receptor degradation and trafficking

  • Expression systems may differ in ubiquitination machinery

  • Impacts receptor half-life and steady-state expression levels

In experimental contexts, the choice of expression system directly affects PTM patterns. Mammalian systems provide the most authentic modifications but at lower yields, while bacterial systems offer higher yields but lack most PTMs. For functional studies, researchers should prioritize systems that maintain appropriate PTMs, particularly glycosylation and palmitoylation .

What methodologies are most effective for purifying functional recombinant bovine MC1R?

Purifying functional recombinant bovine MC1R presents significant challenges due to its membrane-embedded nature. The following methodological approach has proven effective:

1. Membrane preparation:

  • Harvest cells expressing recombinant bovine MC1R

  • Disrupt cells by mechanical homogenization or nitrogen cavitation

  • Isolate membrane fractions by differential centrifugation

  • Wash membranes to remove peripheral proteins

2. Detergent solubilization optimization:

  • Screen detergents for efficacy (recommended starting panel):

    • n-Dodecyl-β-D-maltoside (DDM): 0.5-1%

    • Lauryl maltose neopentyl glycol (LMNG): 0.5-1%

    • Digitonin: 0.5-1%

    • CHAPS: 0.5-1%

  • Include cholesterol hemisuccinate (CHS) at 0.1% to stabilize receptor

  • Maintain physiological pH (7.2-7.4) and include protease inhibitors

  • Solubilize at 4°C for 1-2 hours with gentle agitation

3. Affinity purification:

  • Employ affinity tags strategically positioned to avoid functional interference

  • Common tags: His10, FLAG, or tandem affinity tags

  • For His-tagged proteins, use IMAC with Ni-NTA or Co-Talon resins

  • Include detergent at CMC concentration in all buffers

  • Elute using imidazole gradient or specific peptide competition

4. Size exclusion chromatography:

  • Remove aggregates and purify monomeric receptor

  • Exchange into milder detergents if needed (LMNG or GDN)

  • Typical buffer: 20 mM HEPES pH 7.4, 150 mM NaCl, detergent at CMC, 10% glycerol

5. Functional validation:

  • Verify ligand binding using radioligand binding assays

  • Assess structural integrity using circular dichroism

  • Confirm homogeneity using analytical ultracentrifugation

For structural studies, additional stabilization strategies may be employed, including:

  • Lipid nanodisc reconstitution using MSP proteins and defined lipid mixtures

  • Thermostabilizing mutations based on alanine scanning

  • Addition of high-affinity ligands during purification

  • Antibody fragment or nanobody co-purification

Typical yields range from 0.1-0.5 mg of pure, functional receptor per liter of mammalian cell culture, with higher yields possible from insect cell systems.

How do mutations in bovine MC1R affect its pharmacological properties?

Mutations in bovine MC1R significantly impact its pharmacological properties, with effects that parallel observations in human MC1R variants. Understanding these effects is crucial for structure-function studies and therapeutic development:

Transmembrane domain mutations:

  • Alter the geometry and electrostatic properties of the ligand binding pocket

  • Affect binding affinity for natural agonists (α-MSH, ACTH) and synthetic ligands

  • Mutations equivalent to human R151C and R160W typically reduce agonist affinity by 5-10 fold

  • May create receptors with altered signaling bias or constitutive activity

DRY motif mutations:

  • Disrupt G protein coupling efficiency

  • Severely impair cAMP signaling without necessarily affecting ligand binding

  • Create functionally inactive receptors that can act as dominant negatives when co-expressed with wild-type receptors

C-terminal regulatory site mutations:

  • Impact receptor desensitization and internalization

  • Mutations at phosphorylation sites (equivalent to human T308 and S316) render receptors resistant to GRK6-mediated regulation

  • Result in prolonged signaling due to impaired desensitization

  • Can lead to abnormally high surface expression levels as seen with human D294H variant

Pharmacological consequences:

Mutation RegionBinding Affinity ChangesSignaling EffectsRegulatory Changes
Transmembrane domains5-10 fold decreaseReduced efficacyVariable effects
DRY motifMinimal effect>90% reductionMinimal effect
C-terminal regulatoryMinimal effectExtended durationImpaired desensitization
N-terminalModerate decreaseModerate decreaseMinimal effect

Mutations in bovine MC1R affect not only agonist activity but also antagonist binding and efficacy. Studies show that MC1R variants found in red-haired individuals have different pharmacological responses to both agonists and antagonists compared to wild-type receptors . These differences must be considered when developing MC1R-targeted therapeutics or when using bovine MC1R as a model system.

What are the current applications of recombinant bovine MC1R in cancer research?

Recombinant bovine MC1R serves as a valuable research tool in cancer studies, particularly for melanoma research, offering several key applications:

Comparative oncology models:

  • Provides insight into species-specific differences in melanoma biology

  • Enables development of veterinary therapeutic approaches

  • Serves as a non-human model for testing MC1R-targeted agents

  • Helps identify conserved mechanisms across species with potential translational value

Target validation for therapeutic development:

Radiopharmaceutical targeting:

  • MC1R-targeting radiopharmaceuticals for metastatic melanoma are under clinical investigation

  • [212Pb]VMT01, an MC1R-targeting alpha-particle emitting agent, is being studied in clinical trials

  • Recombinant bovine MC1R systems allow preclinical evaluation of targeting specificity

  • SPECT imaging with [203Pb]VMT01 is being used to assess biodistribution and tumor uptake

Drug screening platforms:

  • Cell lines expressing recombinant bovine MC1R enable high-throughput screening

  • Comparative screening against human and bovine MC1R identifies species-selective compounds

  • Facilitates development of veterinary-specific therapeutics

  • Allows identification of conserved binding sites for broad-spectrum drug development

Structure-function studies:

  • Investigation of MC1R variants with altered functionality

  • Identification of critical domains for drug binding

  • Development of modified ligands with enhanced selectivity or stability

  • Rational design of MC1R-targeted diagnostic and therapeutic agents

Quantitative studies show that MC1R expression correlates with melanoma progression, with statistically significant differences between benign nevi, primary melanomas, and metastatic melanomas (p = 0.0005). Higher MC1R expression is associated with worse 10-year survival in primary melanomas (p = 0.0031) and metastatic melanoma (p = 0.0343) .

How does recombinant bovine MC1R compare with human MC1R in functional assays?

Comparative analysis of recombinant bovine and human MC1R reveals important similarities and differences that impact experimental design and interpretation:

Structural homology:

Pharmacological profiles:

  • Both receptors bind melanocortin peptides with nanomolar affinity

  • α-MSH potency (EC50) typically 0.1-10 nM for both species

  • Subtle differences in rank order potency for synthetic melanocortin analogs

  • Species-specific antagonist sensitivity profiles

Signaling characteristics:

ParameterHuman MC1RBovine MC1RMethodological Approach
cAMP EC50 for α-MSH0.1-1 nM0.5-5 nMELISA or CRE-luciferase assays
Signaling amplitudeHighModerateMaximum fold increase over basal
Constitutive activityPresentLowerBasal cAMP without agonist
Desensitization rateRapidModerateTime-course of cAMP response
GRK specificityGRK2 and GRK6Predominantly GRK6siRNA knockdown studies

Regulatory mechanisms:

  • Human MC1R desensitization is mediated by both GRK2 and GRK6

  • GRK6 specifically mediates internalization of human MC1R by phosphorylating Thr-308 and Ser-316

  • Bovine MC1R likely shares similar regulatory mechanisms with some species-specific differences

  • Mutagenesis studies of equivalent residues in bovine MC1R can confirm conservation of these mechanisms

Experimental considerations:

  • Cell background effects may differ between species

  • Expression systems should be consistent when comparing across species

  • Standardized assay conditions necessary for valid cross-species comparisons

  • Epitope tag positions may affect receptor function differently between species

For direct functional comparisons, researchers should express both receptors in the same cell background under identical conditions to minimize system-dependent variations .

What are the methodologies for studying MC1R-mediated anti-inflammatory effects?

Investigating MC1R-mediated anti-inflammatory effects requires specialized methodologies to capture both molecular signaling events and functional outcomes:

Cell models for MC1R anti-inflammatory studies:

  • Immune cells (macrophages, dendritic cells) transfected with recombinant bovine MC1R

  • Bovine melanocytes expressing endogenous MC1R

  • Microglial cells for neuroinflammation studies

  • Comparative systems with human and bovine MC1R expression

Inflammation induction protocols:

  • Lipopolysaccharide (LPS) stimulation (100 ng/mL, 4-24 hours)

  • Pro-inflammatory cytokine challenge (TNF-α, IL-1β)

  • UV radiation exposure for skin inflammation models

  • Hypoxia-ischemia protocols for neuroinflammation studies

Molecular signaling assessment:

  • Western blotting for NF-κB pathway components (IκB degradation, p65 phosphorylation)

  • Immunofluorescence for NF-κB nuclear translocation

  • cAMP measurement to confirm MC1R activation

  • Phospho-specific antibodies for CREB activation

  • JAK-STAT pathway activation markers

Functional inflammation readouts:

  • Cytokine/chemokine production (ELISA or multiplex assays):

    • Pro-inflammatory: TNF-α, IL-1β, IL-6, IL-8, IL-12

    • Anti-inflammatory: IL-10, TGF-β

  • qPCR for inflammatory gene expression

  • Flow cytometry for cell surface activation markers

  • Nitric oxide production (Griess assay)

  • Expression of adhesion molecules (ICAM-1, VCAM-1)

Neuroinflammation-specific approaches:

  • Microglial morphology and activation state assessment

  • BMS-470539 (MC1R activator) treatment protocol for neuroprotection

  • Analysis of MC1R/cAMP/PKA/Nurr1 signaling pathway

  • Behavioral assessments for functional recovery

For comprehensive analysis, researchers should employ dose-response studies with MC1R agonists (α-MSH or synthetic analogs) and antagonists to establish causality. Knockdown or knockout approaches provide additional validation of MC1R-specific effects versus off-target actions .

How can researchers optimize expression systems for structural studies of bovine MC1R?

Structural studies of bovine MC1R require specialized expression and purification strategies to obtain sufficient quantities of stable, homogeneous protein:

Expression system selection:

  • Insect cell (Sf9/Sf21) expression typically yields 1-2 mg/L of functional receptor

  • Mammalian expression (HEK293S GnTI-) provides more homogeneous glycosylation

  • Both systems can be optimized with inducible promoters and secretion signals

  • Select system based on glycosylation requirements and yield considerations

Construct design optimization:

  • N- and C-terminal truncations to remove flexible regions

  • Thermostabilizing mutations based on alanine scanning

  • Fusion partners to enhance expression and stability:

    • T4 lysozyme or BRIL inserted in intracellular loop 3

    • GFP fusion for expression monitoring and stability assessment

    • Addition of affinity tags (His10, FLAG, Twin-Strep) for purification

Expression enhancement strategies:

  • Codon optimization for expression host

  • Addition of pharmacological chaperones during expression

  • Temperature reduction (27-30°C) during expression phase

  • Sodium butyrate addition (5-10 mM) for mammalian expression

  • Optimized viral MOI (2-5) for baculovirus expression

Stabilization approaches:

  • Co-expression with stabilizing antibody fragments or nanobodies

  • Addition of high-affinity ligands during solubilization

  • Inclusion of lipids (cholesterol, specific phospholipids) in purification buffers

  • Systematic detergent screening for optimal extraction and stability

  • Reconstitution into lipid nanodiscs or amphipols for native-like environment

Quality control metrics:

  • Monodispersity assessment by SEC-MALS

  • Thermal stability measurement using CPM thermal shift assay

  • Ligand binding confirmation via radioligand or fluorescent binding assays

  • Limited proteolysis to identify stable domains

  • Negative stain EM to confirm homogeneity before structural studies

For successful structural determination, researchers typically need to screen multiple constructs and conditions. The recent success with human MC1R Cryo-EM structures provides a valuable template for bovine MC1R studies. These structures revealed detailed information about MC1R complexes bound to endogenous hormone α-MSH, the drug afamelanotide, and synthetic agonists, offering insights applicable to bovine MC1R structural studies .

What is the significance of MC1R variants in non-melanoma skin cancer research?

MC1R variants play crucial roles in non-melanoma skin cancer (NMSC) research, with implications for both human health and comparative veterinary oncology:

Epidemiological significance:

Variant-specific risk profiles:

  • Several specific variants show significant associations with NMSC:

    • V60L: SOR 1.42 (95% CI: 1.19-1.70)

    • D84E: SOR 2.66 (95% CI: 1.06-6.65)

    • V92M, R151C, R160W, R163Q, and D294H also show positive associations

Phenotypic interaction effects:

  • Red hair phenotype modifies the association between MC1R variants and NMSC

  • Consistently higher SORs observed for MC1R variants in individuals without red hair

  • No consistent pattern of association by skin type

  • This suggests complex interactions between genotype and visible phenotype

Functional mechanisms:

  • MC1R variants show altered desensitization efficiency

  • D294H variant demonstrates resistance to internalization, leading to abnormally high surface expression

  • These functional differences may contribute to cancer risk through altered cellular responses to UV damage

  • Co-expression of variant and wild-type MC1R modifies desensitization and internalization behavior

Research applications:

  • Recombinant bovine MC1R systems allow modeling of equivalent variants

  • Comparative studies between wild-type and variant receptors provide insights into functional consequences

  • Development of genotype-specific therapeutic approaches

  • Identification of common mechanisms across species

This research has significant implications for risk assessment and personalized prevention strategies in both human and veterinary medicine. The consistent association between MC1R variants and NMSC risk across multiple studies highlights the importance of MC1R in skin cancer biology beyond its well-established role in melanoma .

How can recombinant bovine MC1R be used to study receptor desensitization mechanisms?

Recombinant bovine MC1R provides an excellent model system for studying GPCR desensitization mechanisms, offering insights into both conserved and species-specific regulatory processes:

Key methodological approaches:

  • Site-directed mutagenesis of potential phosphorylation sites

  • Phospho-specific antibody development for detecting receptor phosphorylation

  • Kinase inhibitor studies to identify responsible GRKs

  • siRNA knockdown of specific GRKs to confirm their role

  • Real-time measurement of receptor internalization using fluorescent tags

Regulatory kinase identification:

  • In human MC1R, both GRK2 and GRK6 mediate desensitization

  • GRK6 specifically mediates internalization by phosphorylating Thr-308 and Ser-316

  • Comparative studies can determine if bovine MC1R shows the same dual regulation

  • Kinase specificity can be assessed through in vitro phosphorylation assays

Phosphorylation site mapping:

  • Create bovine MC1R mutants at residues equivalent to human Thr-308 and Ser-316

  • Generate phosphomimetic (T→D, S→D) and phosphodeficient (T→A, S→A) mutations

  • A T308D/S316D mutant (human equivalent) would mimic constitutively phosphorylated state

  • A T308A/S316A mutant would be resistant to desensitization and internalization

Functional desensitization assessment:

  • Measure cAMP accumulation following repeated agonist exposure

  • Compare desensitization rates between wild-type and mutant receptors

  • Analyze recovery of signaling after agonist removal

  • Determine role of β-arrestins in signal termination

Internalization dynamics:

  • Flow cytometry to quantify surface receptor levels before and after agonist exposure

  • Confocal microscopy with fluorescently tagged receptors to track internalization

  • Co-localization studies with endosomal markers

  • Recycling rate determination following agonist removal

What approaches are used to study cross-species differences in MC1R signaling pathways?

Studying cross-species differences in MC1R signaling pathways requires systematic comparative approaches to identify both conserved and divergent mechanisms:

Parallel expression systems:

  • Establish matched cell lines expressing bovine, human, and other mammalian MC1R orthologs

  • Ensure equivalent expression levels through titratable expression systems

  • Control for cell background effects by using identical host cells

  • Create chimeric receptors with domains swapped between species to identify critical regions

Comparative pharmacology:

  • Generate comprehensive pharmacological profiles for each species variant

  • Determine EC50 and Emax values for conserved agonists (α-MSH, ACTH)

  • Screen synthetic compound libraries for species-selective ligands

  • Identify species-specific antagonists for mechanistic studies

Signaling pathway mapping:

  • Quantitative phosphoproteomics to identify differentially activated pathways

  • BRET/FRET biosensors to measure real-time signaling kinetics

  • RNA-Seq analysis of transcriptional responses to MC1R activation

  • Calcium mobilization and cAMP accumulation in parallel assays

Regulatory mechanism comparison:

  • Identify GRK expression patterns across species

  • Compare desensitization kinetics using matched expression systems

  • Analyze species-specific differences in β-arrestin recruitment

  • Characterize internalization and recycling pathways

Pathway visualization techniques:

  • Live-cell imaging with pathway-specific fluorescent reporters

  • Phospho-flow cytometry for single-cell signaling analysis

  • Multiplex immunoassays for cytokine/chemokine production

  • CRISPR knockout studies of pathway components

Significant cross-species differences have been observed in several aspects of MC1R biology. For example, while human MC1R signaling is prominently associated with pigmentation, MC1R in other species may have more pronounced roles in inflammation regulation or neurological function. The anti-inflammatory effects mediated through pathways like MC1R/cAMP/PKA/Nurr1 may have different potencies across species, necessitating careful comparative analysis when extrapolating between model systems .

How can structural information on MC1R inform therapeutic development strategies?

Structural insights into MC1R provide crucial guidance for therapeutic development strategies, enabling rational design of selective and effective agents:

Key structural features guiding drug design:

  • The recent determination of human MC1R structures bound to various ligands by Cryo-EM

  • Identification of the precise ligand binding pocket architecture

  • Mapping of receptor-G protein interfaces

  • Understanding of conformational changes associated with receptor activation

  • These structural details can be extrapolated to bovine MC1R through homology modeling

Structure-based drug design approaches:

  • Virtual screening against MC1R structural models

  • Fragment-based drug discovery targeting specific binding sites

  • Structure-guided optimization of lead compounds

  • Identification of allosteric binding sites for novel modulators

  • Design of peptide mimetics based on natural ligand structures

Therapeutic targeting strategies:

  • MC1R-targeted radiopharmaceuticals for melanoma therapy:

    • [212Pb]VMT01 (alpha-particle emitting agent) in clinical trials

    • [203Pb]VMT01 for SPECT imaging to assess biodistribution

  • Small molecule modulators for inflammatory conditions

  • Peptide-based therapeutics with enhanced stability and selectivity

  • Bispecific antibodies targeting MC1R and immune checkpoints

Structural basis for MC1R expression as a biomarker:

Structure-guided diagnostic development:

  • Design of MC1R-targeted imaging agents with optimal binding properties

  • Development of antibodies against conformationally distinct epitopes

  • Creation of biosensors for detecting MC1R in clinical samples

  • Rational design of theranostic agents combining imaging and therapeutic capabilities

The emerging structural information on MC1R has validated its potential as a valuable drug target in aggressive melanoma. Clinical trials are now evaluating MC1R-directed therapies, with a phase I trial investigating [212Pb]VMT01 in patients with unresectable or metastatic melanoma. This trial involves up to 52 patients and aims to determine the maximum tolerated dose, with a sub-study using [203Pb]VMT01 to assess biodistribution and tumor uptake .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.