Recombinant Bovine Melatonin receptor type 1A (MTNR1A)

What is Bovine MTNR1A and how does it function in cellular signaling?

Bovine MTNR1A is a high-affinity G protein-coupled receptor (GPCR) belonging to the G-protein coupled receptor 1 family that specifically binds melatonin and mediates its reproductive and circadian actions. The receptor's activity is primarily mediated through pertussis toxin-sensitive G proteins (G i/G o family) that inhibit adenylate cyclase activity, thereby reducing intracellular cAMP levels . This creates a cascade of downstream signaling events that affect cellular functions. The protein consists of 7 transmembrane domains, typical of the GPCR superfamily, with the active recombinant form encompassing residues Gly216~Pro257 of the native protein sequence . Beyond the primary transduction mechanism, MTNR1A can also engage secondary signaling pathways through G q/G 11 family, leading to phospholipase C stimulation and modulation of potassium and calcium channels .

How do expression patterns of MTNR1A vary across bovine tissues?

MTNR1A demonstrates variable expression across different bovine tissues, with notable presence in the pineal gland, retina, brain (particularly suprachiasmatic nucleus), peripheral reproductive tissues including ovaries and testes, and specific regions of the pancreas. The expression pattern correlates with tissues that exhibit strong melatonin-responsive circadian or seasonal rhythmicity. In bovine embryos, MTNR1A expression has been detected through quantitative real-time PCR, immunofluorescence, and Western blot assays . This tissue-specific distribution pattern helps explain the diverse physiological functions mediated by this receptor, particularly its roles in reproductive timing, embryonic development, and metabolic regulation. The receptor's expression often varies seasonally in tissues involved in reproduction, reflecting the role of melatonin in coordinating seasonal breeding in cattle.

What are the structural characteristics of recombinant bovine MTNR1A?

Recombinant bovine MTNR1A protein typically consists of specific amino acid sequences from the native receptor, with commercial preparations often featuring the fragment spanning residues Gly216 to Pro257 (Accession # O02769) . The protein includes an N-terminal His-Tag to facilitate purification and detection, with a predicted molecular mass of approximately 16.6 kDa, though SDS-PAGE analysis reveals an accurate molecular mass closer to 13 kDa . The protein has an isoelectric point of 8.01 and is typically formulated in PBS buffer (pH 7.4) containing 0.01% SKL and 5% Trehalose for stability . The amino acid sequence GLLNQNFRKEYRRIIVSSLCTARVFFVDSSNDVADRVKWKPSPLMTNNVVKVDSV represents a critical fragment of the receptor that maintains important functional characteristics for research applications . These recombinant preparations achieve greater than 90% purity, making them suitable for various research applications including western blotting, ELISA, and as positive controls in assays.

How can recombinant bovine MTNR1A be used in receptor binding assays?

Recombinant bovine MTNR1A can be effectively employed in receptor binding assays to evaluate ligand-receptor interactions, selectivity, and binding affinity. The methodology typically involves immobilizing the recombinant protein (fragment Gly216~Pro257) on a suitable solid phase, followed by incubation with labeled melatonin or analogs . For competitive binding assays, researchers should prepare a dilution series (10^-12 to 10^-4 M) of potential ligands to compete with a fixed concentration of radiolabeled melatonin. Binding parameters including K d (dissociation constant) and B max (maximum binding capacity) can be determined through Scatchard analysis of equilibrium binding data. Binding assays should include positive controls using known melatonin receptor agonists and negative controls with non-specific binding agents. It's critical to maintain consistent experimental conditions, particularly temperature (usually 4°C or 25°C) and pH (typically 7.4), as MTNR1A binding characteristics are sensitive to these parameters.

What expression systems are optimal for producing functional recombinant bovine MTNR1A?

Several expression systems have been optimized for producing functional recombinant bovine MTNR1A, each with distinct advantages. Prokaryotic expression in E. coli represents a cost-effective approach that yields substantial protein quantities, particularly suitable for producing receptor fragments like the Gly216~Pro257 sequence . This system requires optimization of codon usage and may necessitate refolding steps to ensure proper protein conformation. For full-length functional MTNR1A, eukaryotic expression systems including insect cells (Sf9, Sf21) using baculovirus vectors or mammalian cells (HEK293, CHO) are preferred as they provide appropriate post-translational modifications and membrane insertion. Wheat germ cell-free expression systems have also proven effective for producing fragment proteins suitable for applications like SDS-PAGE, ELISA, and Western blotting . When selecting an expression system, researchers should consider the intended application, required protein modifications, and whether membrane integration is necessary for functional studies.

What are the key considerations for experimental design when studying MTNR1A function?

When designing experiments to study bovine MTNR1A function, several critical factors require careful consideration. First, expression verification using quantitative PCR, Western blotting, or immunofluorescence is essential to confirm receptor presence . For functional studies, researchers must account for the circadian nature of melatonin signaling by standardizing the timing of experiments and sample collection. When evaluating downstream signaling, measuring cAMP inhibition provides a primary readout, though secondary pathways including phospholipase C activation and ion channel modulation should also be monitored for comprehensive analysis . Appropriate control conditions must include both vehicle controls and comparative analyses with other melatonin receptor subtypes (particularly MTNR1B) to distinguish receptor-specific effects. In bovine embryonic development studies, culture medium composition significantly influences melatonin receptor response, with optimal melatonin concentrations ranging between 10^-11 and 10^-5 M, with 10^-9 and 10^-7 M demonstrating peak effectiveness . Researchers should also consider potential species differences in receptor pharmacology when translating findings across bovine, human, and rodent systems.

How do genetic variations in bovine MTNR1A influence receptor function and physiological outcomes?

Genetic variations in bovine MTNR1A significantly impact receptor functionality, signaling efficiency, and downstream physiological processes. Single nucleotide polymorphisms (SNPs) can alter ligand binding affinity, G-protein coupling efficiency, and receptor expression levels. Drawing from human studies, variations in the regulatory regions of MTNR1A affect DNA methylation patterns and gene expression levels, potentially explaining individual differences in melatonin signaling effectiveness . In bovine reproductive research, specific MTNR1A polymorphisms correlate with seasonal breeding patterns, conception rates, and embryonic development success . Mechanistically, certain variants are associated with altered methylation of DNA in the regulatory sequence of the MTNR1A gene and weaker expression, resulting in reduced receptor density and diminished melatonin signaling capacity . These genetic differences may explain the variable responses to melatonin supplementation observed in embryonic development protocols, suggesting the need for genotype-based personalization of reproductive technologies in cattle breeding.

What role does MTNR1A play in bovine embryonic development and how can this be experimentally manipulated?

MTNR1A plays a crucial role in bovine embryonic development by mediating melatonin's protective and developmental effects. Experimental evidence demonstrates that melatonin supplementation at concentrations between 10^-11 and 10^-5 M significantly improves in vitro bovine embryo development, with optimal effects at 10^-9 and 10^-7 M . This developmental enhancement occurs in both early culture medium (CR1aa +3 mg/mL BSA) and later culture medium (CR1aa + 6%FBS) . The mechanism involves MTNR1A-mediated upregulation of antioxidative genes (Gpx4, SOD1, bcl-2) and developmentally important genes (SLC2A1, DNMT1A, DSC2) while simultaneously downregulating pro-apoptotic genes (P53, BAX, Caspase-3) . To experimentally manipulate this system, researchers can use receptor-specific antagonists such as luzindole (a non-selective MT1/MT2 antagonist) which blocks melatonin's developmental effects, while 4-P-PDOT (a selective MT2 antagonist) shows minimal impact, confirming MTNR1A's primary role . Additional approaches include siRNA-mediated receptor knockdown, CRISPR-Cas9 gene editing of MTNR1A in embryos, and receptor overexpression studies to further elucidate specific developmental pathways controlled by this receptor.

What are the molecular mechanisms of cross-talk between MTNR1A and other signaling pathways in bovine cells?

MTNR1A engages in complex cross-talk with numerous signaling pathways in bovine cells through both direct protein-protein interactions and indirect signaling cascade convergence. The receptor's primary signaling occurs through Gi/Go proteins, inhibiting adenylate cyclase and reducing cAMP levels, but it also activates secondary pathways via Gq/G11 proteins, stimulating phospholipase C and modulating potassium and calcium channels . MTNR1A signaling intersects with insulin/IGF pathways, particularly relevant in pancreatic beta cells where melatonin modulates glucose homeostasis, connecting circadian rhythms with metabolic regulation . In bovine reproductive tissues, MTNR1A interacts with gonadotropin signaling, influencing seasonal breeding patterns. At the molecular level, MTNR1A activation affects MAP kinase pathways, calcium signaling, and antioxidative responses. The receptor can undergo heterodimerization with other GPCRs, creating complex signaling units with modified pharmacological properties. Research methods to study these interactions include co-immunoprecipitation, proximity ligation assays, BRET/FRET techniques for protein interactions, and phosphoproteomic analyses to trace downstream signaling events.

How can researchers effectively validate antibodies for bovine MTNR1A detection in various applications?

Thorough validation of antibodies for bovine MTNR1A detection requires a systematic approach across multiple techniques. Researchers should begin with positive controls using recombinant bovine MTNR1A protein (such as the fragment spanning Gly216~Pro257), alongside negative controls with tissues from receptor knockout models or cells where the receptor is not expressed . Western blot validation should confirm appropriate molecular weight detection (expected ~40 kDa for full-length receptor, ~13-16.6 kDa for recombinant fragments) and include peptide competition assays to verify specificity . For immunohistochemistry and immunofluorescence, method validation should include parallel staining with multiple antibodies targeting different epitopes of the receptor. Cross-reactivity testing against MTNR1B is essential due to the structural similarity between melatonin receptor subtypes. Researchers should evaluate antibody performance across different fixation methods and sample preparation techniques, particularly since membrane protein preservation requires specific considerations. Quantitative assessment of signal-to-background ratio provides important validation metrics, with values exceeding 5:1 generally considered acceptable for high-quality detection.

What are the most robust protocols for measuring MTNR1A-mediated signal transduction in bovine cells?

Measuring MTNR1A-mediated signal transduction in bovine cells requires comprehensive assessment of multiple downstream pathways using established protocols. For primary G-protein signaling through Gi/Go, researchers should measure cAMP inhibition following forskolin stimulation, using either ELISA-based detection or modern bioluminescence resonance energy transfer (BRET) biosensors for real-time monitoring . Secondary signaling through Gq/G11 can be assessed by measuring intracellular calcium mobilization using fluorescent calcium indicators such as Fura-2 or genetically encoded calcium indicators. Downstream signaling pathway activation should be monitored through phosphorylation status of key proteins including ERK1/2, Akt, and CREB using phospho-specific antibodies in Western blotting or cellular imaging approaches. For gene regulation studies, quantitative real-time PCR should target known melatonin-responsive genes including antioxidative genes (Gpx4, SOD1, bcl-2) and developmental genes (SLC2A1, DNMT1A, and DSC2) . Control experiments must include specific receptor antagonists (luzindole for non-selective MT1/MT2 inhibition and 4-P-PDOT for selective MT2 inhibition) to confirm signal specificity to MTNR1A .

What strategies can overcome common challenges in expressing and purifying functional bovine MTNR1A?

Expression and purification of functional bovine MTNR1A presents several challenges that can be addressed through optimized strategies. For bacterial expression systems, codon optimization for E. coli is essential to overcome rare codon bias in bovine sequences, while inclusion of solubility tags (MBP, SUMO, or Thioredoxin) can improve protein folding and solubility . When expressing membrane proteins like full-length MTNR1A, detergent screening is critical, with mild detergents (DDM, LMNG, or GDN) typically preserving receptor structure better than harsh ionic detergents. For insect or mammalian cell expression, baculovirus expression vector systems (BEVS) or transient transfection with optimized signal sequences improve membrane insertion and trafficking. Purification strategies should employ affinity chromatography utilizing the N-terminal His-tag, followed by size exclusion chromatography to ensure homogeneity . For functional studies, reconstitution into nanodiscs or liposomes provides a native-like membrane environment. Stability during purification can be enhanced by performing all steps at 4°C and including receptor ligands (melatonin analogs) and cholesterol derivatives during extraction and purification to stabilize the receptor conformation. Quality control should include binding assays with radiolabeled melatonin to confirm functionality throughout the purification process.

How do MTNR1A genetic variants influence metabolic phenotypes in bovines compared to humans?

Recent research has revealed important parallels and distinctions between bovine and human MTNR1A genetic variants and their metabolic impacts. In humans, specific MTNR1A variants (rs62350392, rs2119883, and rs13147179) have been newly identified as significantly linked to familial type 2 diabetes, representing the first evidence of MTNR1A as a novel risk gene in human T2D . Comparatively, in bovines, MTNR1A variants influence glucose metabolism and insulin secretion patterns, though with species-specific phenotypic expressions that reflect differences in diurnal vs. nocturnal physiology. The mechanistic basis appears similar across species, with genetic variations affecting receptor expression levels, signaling efficiency, and downstream metabolic gene regulation. Both species show MTNR1A expression in pancreatic beta cells where the receptor mediates melatonin's glucometabolic roles and influences insulin secretion . These genetic variations may explain observed differences in feed efficiency and metabolic resilience among cattle breeds. For researchers, these findings suggest that bovine models may serve as valuable systems for studying certain aspects of human metabolic disorders, particularly those involving circadian disruption, while acknowledging important species-specific differences in melatonin's temporal signaling patterns.

What is the relationship between MTNR1A function and circadian rhythm regulation in bovine physiology?

MTNR1A serves as a critical molecular link connecting environmental light cues to circadian physiological regulation in bovines. The receptor mediates melatonin's effects on circadian clock genes in multiple tissues, participating in a negative feedback loop where melatonin (produced during darkness) signals through MTNR1A to influence expression of clock genes including CLOCK, BMAL1, PER, and CRY. Unlike humans, bovines show less disruption from artificial lighting, but modern dairy farming practices with extended lighting periods can alter natural melatonin rhythms and MTNR1A signaling. MTNR1A signaling in the bovine pineal gland, retina, and hypothalamus coordinates seasonal reproductive timing through inhibition of GnRH and gonadotropin release during short-day seasons . The MTNR1A gene contains response elements for clock transcription factors, creating bidirectional regulation between melatonin signaling and the molecular clock machinery. Research techniques to study these relationships include continuous monitoring of activity patterns, body temperature rhythms, and circulating hormone levels correlated with MTNR1A expression and genetic variants. Findings from studies on shift work in humans suggest potential parallels for managing bovine agricultural schedules, as common variations in MTNR1A impact tolerance to circadian disruption .