Recombinant Bovine Membrane-spanning 4-domains subfamily A member 13 (MS4A13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us and we will prioritize developing the specified tag.
Synonyms
MS4A13; Membrane-spanning 4-domains subfamily A member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MS4A13
Target Protein Sequence
MTGIFCIFMWYLLLILYMGQIKGVFGTYEPITYKTGCSLWGIFFIISGISIIRATWYPSQ RQLTCAMLENILCMILAIISMILTIVELSTFKSVSYRNYGQAKLGRQISRVLLSFYPLEV SMALTYSIFGCVGLCRKKEDARTADTEEVEDAF
Uniprot No.

Target Background

Function
MS4A13 may be involved in signal transduction as a component of a multimeric receptor complex.
Database Links
Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is bovine MS4A13 and how does it relate to other MS4A family members?

Bovine Membrane-spanning 4-domains subfamily A member 13 (MS4A13) is a protein-coding gene found in Bos taurus (cattle) with Entrez Gene ID 505705 . It belongs to the broader MS4A gene family, which includes several related proteins such as MS4A4A, MS4A4E, MS4A2, and MS4A6A. These proteins are characterized by their four transmembrane domains, suggesting potential roles in signal transduction or molecular transport across membranes.

Comparative genomic analyses between bovine MS4A13 and human MS4A family members would be particularly valuable for identifying conserved functional domains and species-specific adaptations. Such analyses would help determine whether findings from human MS4A research might be applicable to understanding bovine MS4A13 function.

What approaches are most effective for predicting the structure and functional domains of bovine MS4A13?

As a membrane protein with four predicted transmembrane domains, MS4A13 presents challenges for structural characterization. Researchers should employ multiple complementary approaches:

  • Bioinformatic prediction tools: Programs like TMHMM, Phobius, and TOPCONS can predict transmembrane regions, while tools like InterPro can identify conserved functional domains.

  • Homology modeling: Based on available structures of related proteins, researchers can generate predicted 3D models of MS4A13 to guide functional hypotheses.

  • Hydropathy analysis: Kyte-Doolittle or similar plots can confirm predicted membrane-spanning regions and identify potential functional loops.

  • Conservation analysis: Multiple sequence alignment across species and MS4A family members can reveal highly conserved residues likely critical for function.

For experimental validation of these predictions, techniques such as cysteine accessibility methods, glycosylation mapping, and epitope insertion can determine membrane topology. More advanced approaches like hydrogen-deuterium exchange mass spectrometry could provide insights into protein dynamics and conformational changes, though they require significant optimization for membrane proteins.

When designing experiments based on structural predictions, researchers should remain aware that computational models have limitations, particularly for membrane proteins where experimental structures are often lacking. Multiple prediction methods should be employed and results compared for consistency.

What expression systems are optimal for producing recombinant bovine MS4A13?

The selection of an appropriate expression system is critical for obtaining functional recombinant bovine MS4A13. Each system offers distinct advantages and limitations:

  • Bacterial systems (E. coli): While cost-effective and high-yielding, they often produce misfolded membrane proteins in inclusion bodies. If using E. coli, consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression, along with fusion partners that enhance solubility.

  • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae): These provide a eukaryotic environment with better machinery for membrane protein folding. P. pastoris can achieve high cell densities and offers controlled induction with methanol.

  • Insect cell systems (Sf9, High Five): The baculovirus expression system provides advanced eukaryotic processing capabilities and has proven successful for many mammalian membrane proteins.

  • Mammalian cell systems (HEK293, CHO): These offer the most native-like environment for bovine proteins, including proper post-translational modifications and membrane composition, though yields are typically lower.

For initial characterization studies, testing multiple expression systems in parallel can identify optimal conditions. When designing expression constructs, consider incorporating:

  • A cleavable N-terminal signal sequence to ensure proper membrane targeting

  • Affinity tags positioned to avoid interference with transmembrane domains

  • Fusion partners that enhance stability or expression (e.g., GFP for folding assessment)

  • Codon optimization for the selected expression host

The choice of expression system should align with research objectives, whether prioritizing high yield, native conformation, or specific post-translational modifications.

What purification strategies overcome the challenges of isolating membrane proteins like MS4A13?

Purifying membrane proteins like MS4A13 requires specialized approaches to maintain structural integrity while removing the protein from its native lipid environment. A systematic purification strategy should include:

  • Membrane extraction optimization:

    • Screen multiple detergents (e.g., DDM, LMNG, GDN) at various concentrations

    • Consider detergent-lipid mixtures to maintain stability

    • Test solubilization time, temperature, and buffer composition

  • Affinity chromatography:

    • Use genetically incorporated tags (His, FLAG, Strep) positioned to remain accessible

    • Maintain detergent above critical micelle concentration throughout purification

    • Include glycerol or specific lipids to enhance stability

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and assess homogeneity

    • Ion exchange chromatography for further purification if needed

    • Consider lipid nanodiscs or amphipols for downstream applications requiring detergent removal

  • Quality control assessments:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Size exclusion chromatography with multi-angle light scattering to determine protein-detergent complex size

    • Thermal stability assays to optimize buffer conditions

The purification protocol should be systematically optimized with small-scale tests before scaling up. Throughout purification, samples should be monitored for aggregation, degradation, and loss of structural integrity using techniques like dynamic light scattering and circular dichroism spectroscopy.

How can researchers determine the tissue distribution and expression patterns of bovine MS4A13?

Understanding the tissue distribution of MS4A13 is foundational for elucidating its biological function. A comprehensive expression analysis should employ multiple complementary techniques:

  • Transcriptomic approaches:

    • RNA-seq analysis across multiple bovine tissues and developmental stages

    • Single-cell RNA sequencing to identify specific cell populations expressing MS4A13

    • Quantitative RT-PCR with carefully validated primers for targeted analysis

  • Protein-level detection:

    • Western blotting of tissue lysates with validated antibodies

    • Immunohistochemistry or immunofluorescence for spatial localization

    • Proteomics analysis of membrane fractions from various tissues

  • Reporter systems:

    • BAC transgenic approaches incorporating reporter genes under native MS4A13 regulatory elements

    • CRISPR knock-in of fluorescent tags at the endogenous locus

When analyzing expression data, researchers should consider developmental timing, physiological state, and potential regulation by environmental factors. For tissues showing significant expression, further investigation of subcellular localization through co-localization studies with organelle markers can provide insights into function.

The methodology for studying RNA expression patterns of specific genes during differentiation has been well established in bovine systems, as demonstrated in studies examining transcriptional remodeling during muscle differentiation upon serum starvation . Similar approaches could be applied to characterize MS4A13 expression dynamics.

What experimental designs best elucidate the potential interactions between MS4A13 and other proteins?

Identifying protein interaction partners is crucial for understanding MS4A13 function. Several complementary approaches should be considered:

  • Proximity-based methods:

    • BioID or TurboID fusion proteins to identify proximal proteins in living cells

    • APEX2 proximity labeling for temporal resolution of interactions

    • Crosslinking mass spectrometry to capture direct interactions

  • Affinity-based methods:

    • Co-immunoprecipitation with MS4A13-specific antibodies

    • Tandem affinity purification with tagged MS4A13

    • Pull-down assays with recombinant MS4A13 domains

  • Direct interaction assessment:

    • Fluorescence resonance energy transfer (FRET) for candidate interactions

    • Split-protein complementation assays (BiFC, NanoBiT)

    • Surface plasmon resonance or microscale thermophoresis for binding kinetics

  • Functional validation:

    • Co-localization studies in relevant cell types

    • Genetic perturbation of interaction partners

    • Mutagenesis of predicted interaction interfaces

Based on knowledge from other MS4A family members, investigation of potential interactions with signaling receptors would be particularly interesting. For example, human MS4A4A has been linked to TREM2 processing, suggesting that MS4A proteins may participate in receptor trafficking or processing . Researchers should investigate whether bovine MS4A13 plays similar roles in processing or trafficking of membrane receptors in bovine cells.

How can CRISPR-Cas9 genome editing be optimized for studying MS4A13 function in bovine cells?

CRISPR-Cas9 technology offers powerful approaches for investigating MS4A13 function through precise genetic manipulation. For effective application in bovine systems:

  • Guide RNA design considerations:

    • Target early exons to ensure complete loss-of-function in knockout studies

    • Use multiple bioinformatic tools to predict off-target effects

    • Consider chromatin accessibility at the target site

    • Design homology-directed repair templates with at least 800bp homology arms

  • Delivery optimization for bovine cells:

    • Compare nucleofection, lipofection, and viral delivery methods

    • Test multiple cell types relevant to MS4A13 expression

    • Optimize Cas9:gRNA ratios for highest editing efficiency

    • Consider RNP delivery to reduce off-target effects

  • Editing strategy selection:

    • Gene knockout through frameshift mutations or exon deletion

    • Precise point mutations to assess specific amino acid functions

    • Knock-in of reporter genes or epitope tags

    • Base editing or prime editing for specific nucleotide changes without DSBs

  • Validation approaches:

    • Deep sequencing to quantify editing efficiency

    • Western blotting to confirm protein loss in knockouts

    • RT-PCR to identify potential aberrant splicing

    • Off-target analysis through whole genome sequencing

For functional studies, researchers could develop isogenic cell lines with MS4A13 knockout or specific mutations, allowing direct comparison of phenotypes under identical genetic backgrounds. Conditional knockout systems using Cre-lox or inducible degradation approaches could help study proteins where complete loss might affect cell viability.

When designing genetic studies, researchers should consider potential compensatory mechanisms by other MS4A family members, which might mask phenotypes in single-gene knockout models.

What insights can comparative genomics provide about the evolution and function of bovine MS4A13?

Comparative genomic approaches can reveal evolutionary pressures and functional constraints on MS4A13, guiding hypothesis development about its biological roles:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of MS4A family members across species

    • Identify orthologous relationships between bovine MS4A13 and genes in other species

    • Determine when gene duplication events occurred in the MS4A family

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under purifying or positive selection

    • Identify conserved domains likely critical for function

    • Detect lineage-specific acceleration that may indicate specialized functions

  • Synteny analysis:

    • Examine conservation of genomic context around MS4A13

    • Identify shared regulatory elements across species

    • Detect potential co-evolution with functionally related genes

  • Variation analysis:

    • Survey polymorphisms in MS4A13 across bovine breeds

    • Identify variants associated with phenotypic differences

    • Compare to human variation in MS4A genes associated with disease

Studies of the human MS4A gene cluster have revealed significant associations with soluble TREM2 levels, particularly through variants like rs1582763, an intergenic variant near MS4A4A, and rs6591561, a missense variant (p.M159V) within MS4A4A . Comparative analysis could determine whether similar functionally relevant variants exist in bovine MS4A13 and whether the association with TREM2 processing is evolutionarily conserved.

When conducting comparative analyses, researchers should consider tissue-specific expression patterns across species, as functional conservation might not always correlate with sequence conservation if expression contexts differ.

How might MS4A13 function in cellular signaling pathways based on structural similarities with other MS4A proteins?

The four-transmembrane domain structure of MS4A proteins suggests potential roles in cellular signaling, possibly as adaptor proteins, ion channels, or components of receptor complexes. Based on knowledge of other MS4A family members, several hypotheses for MS4A13 function can be formulated:

  • Adaptor protein function:

    • MS4A13 might serve as a scaffold for signaling complexes

    • Intracellular domains could recruit cytoplasmic signaling molecules

    • Extracellular domains might interact with soluble ligands or other membrane proteins

  • Ion channel or transporter activity:

    • The transmembrane domains could form a pore or channel

    • MS4A13 might regulate calcium signaling, as suggested for some MS4A proteins

    • It could function as part of a larger channel complex

  • Receptor processing or trafficking:

    • MS4A13 might regulate the surface expression or endocytosis of other receptors

    • It could influence proteolytic processing, similar to how MS4A4A may affect TREM2 cleavage

    • It might participate in protein quality control in the secretory pathway

  • Lipid raft association:

    • MS4A13 could organize specialized membrane microdomains

    • It might regulate the composition or function of lipid rafts

    • This organization could affect signaling receptor clustering

To investigate these possibilities, researchers should consider experimental approaches that probe membrane organization, protein-protein interactions, and dynamic cellular processes. Techniques such as live-cell imaging of tagged MS4A13, proximity labeling combined with proteomics, and functional assays after genetic perturbation would help distinguish between these potential functions.

The significant association between MS4A4A variants and soluble TREM2 levels observed in human studies suggests that investigating potential relationships between bovine MS4A13 and TREM2 or similar receptors would be a promising research direction.

What experimental approaches can address the challenges of studying membrane protein function in native cellular environments?

Studying membrane proteins like MS4A13 in their native context presents unique challenges that require specialized approaches:

  • Maintaining native membrane environments:

    • Use of native membrane preparations rather than detergent-solubilized proteins

    • Reconstitution into lipid nanodiscs with native lipid compositions

    • Application of styrene-maleic acid copolymer lipid particles (SMALPs) to extract membrane protein complexes with surrounding lipids

  • Visualization strategies:

    • Super-resolution microscopy techniques (STORM, PALM) to visualize protein clustering beyond the diffraction limit

    • Single-particle tracking to monitor dynamic behavior in living cells

    • Correlative light and electron microscopy to combine functional and structural information

  • Functional assessment in situ:

    • Optogenetic approaches for temporal control of protein activity

    • Acute protein degradation systems (e.g., AID, PROTAC) for rapid functional perturbation

    • Local concentration perturbation using chemically-induced dimerization

  • Detecting conformational changes:

    • FRET-based sensors to detect protein activation or conformational changes

    • Accessibility labeling to identify dynamic regions

    • Nanobodies or intrabodies that recognize specific conformational states

For MS4A13 specifically, researchers might develop fluorescent reporters that detect changes in local ion concentrations or signaling events potentially regulated by this protein. Systems like the split GFP complementation assay could monitor MS4A13 interactions with candidate partners in living cells.

When designing experiments, researchers should consider the limitations of each approach and implement controls that distinguish specific effects from artifacts. For example, tag-induced mislocalization can be controlled by comparing multiple tagging strategies and validating with antibodies against the native protein.

How can multi-omics approaches be integrated to comprehensively understand MS4A13 biology?

A holistic understanding of MS4A13 function requires integration of data from multiple omics platforms and experimental approaches:

  • Multi-omics data integration strategies:

    • Correlation analysis between transcriptomic and proteomic data to identify post-transcriptional regulation

    • Network analysis incorporating protein-protein interaction data with expression patterns

    • Integration of genomic variation with expression quantitative trait loci (eQTLs)

    • Mapping of epigenomic features to understand regulatory mechanisms

  • Computational approaches for integration:

    • Machine learning methods to identify patterns across diverse datasets

    • Bayesian networks to infer causal relationships

    • Dimensionality reduction techniques to visualize complex relationships

    • Knowledge graph approaches incorporating published literature

  • Validation of integrated hypotheses:

    • Targeted experimental testing of computationally derived hypotheses

    • Development of predictive models that can be experimentally verified

    • Iterative refinement of models based on new experimental data

Studies on muscle differentiation have demonstrated how RNA-seq can reveal tissue-specific expression patterns and transcriptional changes during developmental processes . Similar approaches could identify the tissues and developmental stages where MS4A13 plays critical roles, particularly when integrated with proteomic and functional data.

What is the potential relevance of bovine MS4A13 research to understanding human MS4A biology and disease associations?

The comparative study of bovine MS4A13 and human MS4A proteins can provide valuable insights with potential translational relevance:

  • Evolutionary conservation of function:

    • Determining whether functional mechanisms identified in bovine MS4A13 are conserved in human MS4A proteins

    • Identifying species-specific adaptations versus core conserved functions

    • Using bovine models to study basic biological processes relevant to human health

  • Comparative pathophysiology:

    • Investigating whether bovine diseases involve MS4A13 dysfunction similar to human MS4A associations with Alzheimer's disease

    • Comparing immune system roles of MS4A proteins across species

    • Identifying shared signaling pathways affected by MS4A proteins

  • Therapeutic target identification:

    • Using knowledge of bovine MS4A13 structure and function to inform human MS4A targeting

    • Developing screening systems in bovine cells for preliminary evaluation of therapeutic approaches

    • Identifying critical protein-protein interactions conserved across species

Human studies have identified significant associations between the MS4A gene cluster and Alzheimer's disease biomarkers, particularly soluble TREM2 levels . The top SNP, rs1582763, near MS4A4A, was strongly associated with CSF sTREM2 (β = 735.1, P = 1.15×10^-15) . Understanding the fundamental biology of MS4A proteins across species could help elucidate the mechanisms underlying these disease associations.

While direct extrapolation from bovine to human systems requires caution due to species differences, comparative studies can identify evolutionarily conserved mechanisms that are more likely to be functionally significant and therefore relevant to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.