Recombinant Bovine Mesoderm-specific transcript homolog protein (MEST)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MEST; PEG1; Mesoderm-specific transcript homolog protein; Paternally-expressed gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MEST
Target Protein Sequence
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLSFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQSRRINLLSHDYGDTVAQELLYRFKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGMLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Uniprot No.

Target Background

Database Links
Protein Families
AB hydrolase superfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
No detectable transcripts during preimplantation development. Isoform 1 was not detected in either in vitro-matured oocytes (IVF) or parthenogenetically activated (PA) blastocyst. Isoform 2 was expressed in IVF and PA blastocysts.

Q&A

What is the fundamental structure and expression pattern of MEST?

MEST is an imprinted gene that is transcribed from the paternal allele in both mice and humans, at least during early developmental stages . The protein contains an α/β hydrolase fold characteristic of many enzymatic proteins, suggesting a potential catalytic function that remains to be fully characterized . In mice, Mest protein has been identified as an approximately 53-kDa protein through immunoblotting analysis with anti-Mest protein antibodies .

Expression analysis reveals that MEST was originally identified as highly abundant in the mesoderm and its derivatives . In adipose tissue specifically, MEST expression levels have been shown to correlate closely with accumulated fat mass in various mouse depots .

How does MEST function in normal development versus pathological states?

In normal development, MEST plays roles in mesodermal differentiation and is subject to imprinting regulations. During pathological states such as obesity, MEST expression is significantly upregulated in white adipose tissue (WAT) . This upregulation appears to be dynamically regulated between individuals with varying weight gain profiles, despite identical genetic backgrounds in experimental models .

Studies have demonstrated that MEST expression is promoted by diets high in both unsaturated and saturated fats, while this induction can be prevented when animals are simultaneously exposed to cold stress conditions (4°C), which typically prevents diet-induced weight gain .

What is the paradoxical relationship between MEST expression and adipocyte differentiation?

One of the most intriguing aspects of MEST biology is the seemingly contradictory relationship between its expression and function in adipogenesis. While MEST expression increases during human adipocyte differentiation and correlates positively with adipocyte volume in obese states , functional studies reveal an unexpected inverse relationship with adipogenic capacity.

Knockdown of MEST during human adipocyte differentiation results in increased lipid accumulation and enhanced expression of adipocyte marker genes . Conversely, overexpression of MEST reduces human adipocyte differentiation . This apparent paradox suggests that MEST may function as a negative regulator of adipogenesis despite being upregulated during this process, possibly as part of a feedback mechanism to control excessive adipocyte expansion.

What signaling pathways interact with MEST during adipocyte differentiation?

Microarray analysis following MEST knockdown has revealed significant promotion of PPAR signaling and glycolysis pathways . This suggests that MEST may normally function to suppress these pathways, which are known to promote adipogenesis.

Interestingly, knockdown of MEST has been shown to fully substitute for the phosphodiesterase inhibitor 3-isobutyl-1-methylxanthine (IBMX) as an inducer of adipogenesis . This indicates that MEST may be involved in cAMP-dependent signaling pathways that regulate the early stages of adipocyte differentiation.

How do genetic modifications of MEST affect adipose tissue development in vivo?

Transgenic mouse models have provided valuable insights into MEST function in vivo. Mice overexpressing Mest in the adipogenic lineage display an enlargement of adipocyte size , consistent with MEST's correlation with adiposity. In contrast, global Mest knockout mice exhibit reduced adiposity .

What cell culture models are optimal for studying MEST function?

Based on current research, the 3T3-L1 mouse preadipocyte cell line has been effectively used to study MEST function in adipogenesis . This established model allows for:

  • Transfection of expression vectors or siRNA for MEST

  • Selection of stable transformants using neomycin resistance

  • Comparison of adipogenic potential between MEST-modified and control cells

  • Analysis of molecular pathways affected by MEST alterations

Researchers should maintain these cells in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% Calf serum (CS) at 37°C in the presence of 5% CO₂ .

What transfection protocols are effective for MEST expression vectors?

For optimal transfection of MEST expression vectors into preadipocyte cell lines like 3T3-L1, the following protocol has proven effective:

  • Seed 5 × 10⁵ cells onto 60-mm dishes one day prior to transfection in DMEM supplemented with 10% CS

  • Treat cells with a complex of Lipofectamine 3000 and 5 μg of plasmid DNA

  • After 24 hours of incubation, trypsinize cells and seed into 100-mm dishes

  • Select neomycin-resistant cells with 1 mg/mL G418

This method allows for the establishment of stable cell lines expressing recombinant MEST for long-term studies of its effects on adipocyte differentiation and function.

How can MEST expression be verified in experimental models?

To verify successful expression of recombinant MEST in experimental models, researchers should employ both mRNA and protein detection methods:

  • RNA analysis: Quantitative RT-PCR can be used to measure MEST mRNA levels, comparing expression between transfected cells and appropriate controls

  • Protein detection: Immunoblotting with specific anti-MEST antibodies can confirm protein expression, with expected detection of approximately 53-kDa band corresponding to the MEST protein

Visual representation of expression differences, as demonstrated in Figure 1 of the referenced study , provides clear evidence of successful MEST manipulation.

What transcriptomic approaches can detect changes in MEST-regulated pathways?

While not specifically focused on MEST, recent advances in transcriptomic technology offer powerful approaches for studying MEST-regulated pathways:

  • High-throughput real-time PCR systems: Enable analysis of multiple genes simultaneously in large sample numbers

  • RNA sequencing (RNA-seq): Performs massive measurements of the transcriptome for comprehensive pathway analysis

  • Microarrays: Allow targeted analysis of specific gene sets affected by MEST manipulation

These technologies have already demonstrated value in related fields, as shown in studies detecting transcriptomic changes in response to recombinant bovine somatotropin (rbST) in dairy cattle .

How can researchers analyze tissue-specific effects of MEST in vivo?

For researchers studying MEST function in vivo, particularly in adipose tissue, several approaches have proven effective:

  • Direct tissue analysis: Post-mortem analysis of adipose tissue provides comprehensive insights but is limited in longitudinal studies

  • Cell isolation from tissues: Similar to milk somatic cells used in other studies, isolation of specific cell populations from adipose tissue allows examination of MEST effects in specific cell types while minimizing invasive procedures

  • Multiple time-point sampling: Collection of samples at different timepoints throughout experimental interventions enables tracking of MEST expression dynamics in response to dietary or pharmacological treatments

How should researchers interpret contradictory findings on MEST function?

The apparent paradox that MEST expression increases during adipogenesis while functionally inhibiting this process requires careful interpretation. Researchers should consider:

  • Temporal dynamics: MEST may have different functions at different stages of adipocyte differentiation

  • Feedback mechanisms: Increased MEST expression may represent a compensatory response to limit excessive adipogenesis

  • Context-dependent effects: MEST function may vary depending on the metabolic state, species, or specific adipose depot being studied

What are the technical challenges in producing recombinant bovine MEST protein?

While the search results don't specifically address production of recombinant bovine MEST, researchers can apply principles from other recombinant protein production systems:

  • Expression system selection: Bacterial, yeast, insect, or mammalian expression systems each offer advantages for different research applications

  • Protein folding considerations: The α/β hydrolase fold of MEST requires proper folding for functional studies, which may necessitate eukaryotic expression systems

  • Purification strategy: Design of purification protocols must account for MEST's biochemical properties and potential enzymatic activity

What experimental approaches can determine MEST's enzymatic function?

Despite the α/β hydrolase fold suggesting enzymatic activity, MEST's specific catalytic function remains unidentified. Researchers should consider:

  • Substrate screening: Systematic testing of potential substrates relevant to lipid metabolism, given MEST's association with adiposity

  • Structure-function analysis: Site-directed mutagenesis of putative catalytic residues to identify those essential for function

  • Proteomics approaches: Identification of MEST-interacting proteins that may provide clues to its biochemical function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.