Recombinant Bovine Microsomal glutathione S-transferase 2 (MGST2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGST2; Microsomal glutathione S-transferase 2; Microsomal GST-2; Glutathione peroxidase MGST2; Leukotriene C4 synthase MGST2; Microsomal glutathione S-transferase II; Microsomal GST-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MGST2
Target Protein Sequence
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
Uniprot No.
Target Background
Function
Recombinant Bovine Microsomal glutathione S-transferase 2 (MGST2) catalyzes several glutathione-dependent reactions. These include the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE; glutathione transferase activity toward xenobiotic electrophiles, such as 1-chloro-2,4-dinitrobenzene (CDNB); and the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4). MGST2 is also implicated in oxidative DNA damage induced by ER stress and anticancer agents through activation of the LTC4 biosynthetic pathway in non-immune cells.
Database Links
Protein Families
MAPEG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
