Recombinant Bovine Mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of SLC25A11

SLC25A11, also known as mitochondrial 2-oxoglutarate/malate carrier protein, is a 314 amino acid multi-pass transmembrane protein belonging to the mitochondrial carrier protein family. As an oxoglutarate/malate carrier, SLC25A11 transports 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for dicarboxylic acids and malate . This protein contains three solcar repeats, which is a characteristic feature of substrate carrier proteins in the mitochondria .

The bovine 2-oxoglutarate/malate carrier protein was one of the first mitochondrial carriers to be extensively characterized at the molecular level. Its amino acid sequence was deduced from overlapping cDNA clones generated through polymerase chain reactions . The mature protein has a modified alpha-amino group, though the precise position of the mature N-terminal amino acid has not been fully determined, although it must lie within amino acids 1-4 of the deduced protein sequence .

Primary Structure

The bovine SLC25A11 protein consists of 314 amino acids including the initiator methionine . Sequence analysis reveals a protein with a highly organized structure that reflects its specialized transport function. The primary structure contains specific motifs that are critical for substrate recognition and transport.

Three-Domain Repeating Pattern

A distinctive feature of SLC25A11 is its three-fold repeated sequence structure, with each repeat approximately 100 amino acids in length . This pattern is common among mitochondrial carrier proteins and suggests an evolutionary relationship between different members of this family. Comparison of the SLC25A11 protein sequence with other mitochondrial carrier proteins, including ADP/ATP translocase, the phosphate carrier, and the uncoupling protein from brown fat, confirms that all these proteins contain similar three-fold repeated sequences, indicating they likely evolved from a common ancestral protein .

Transmembrane Organization

The distribution of hydrophobic amino acids in the oxoglutarate/malate carrier supports a structural motif possibly consisting of two transmembrane alpha-helices joined by an extensive extramembranous hydrophilic region . This organization is critical for the protein's function in facilitating substrate transport across the mitochondrial inner membrane.

Gate Mechanisms

SLC25A11, like other mitochondrial carriers, has a single substrate-binding site and two gates present on either side of the membrane that involve salt-bridge networks . The protein contains matrix and cytoplasmic gates that are approximately 15-Å thick, providing insulation against proton leak, which is crucial for maintaining the proton motive force necessary for energy conversion in mitochondria .

Transport Mechanism

The primary function of SLC25A11 is to catalyze the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids . This transport process follows a precise 1:1 stoichiometry, ensuring balanced exchange of metabolites .

The transport mechanism likely involves coordinated movement of six structural elements leading to the alternating opening and closing of the matrix or cytoplasmic side of the carrier . This alternating access mechanism ensures that the substrate-binding site is never simultaneously accessible from both sides of the membrane, preventing unregulated metabolite flow.

Role of Salt-Bridge Networks

Critical to the function of SLC25A11 are two salt-bridge networks:

  1. The matrix salt-bridge network and glutamine brace (Px[DE]xx[KR]xxxQ)

  2. The cytoplasmic salt-bridge network and tyrosine brace ([YF][DE]xx[KR])

These networks are key components of the gates that open and close the transporter, exposing the substrate-binding site to one or other side of the membrane . The matrix salt-bridge network is highly conserved across the SLC25 family with relatively few substitutions, whereas the cytoplasmic salt-bridge network shows greater variability .

Substrate Specificity and Binding

SLC25A11 exhibits specific substrate preferences, primarily transporting 2-oxoglutarate in exchange for malate. The binding of succinate to the matrix side of the carrier increases the affinity for malate, demonstrating allosteric regulation of transport activity .

Involvement in Metabolic Shuttles

SLC25A11 plays a crucial role in several metabolic pathways, including:

  1. The malate-aspartate shuttle: SLC25A11 participates in this shuttle by exporting oxoglutarate in exchange for malate . The imported malate is converted into oxaloacetate, which in turn is converted into oxoglutarate by glutamate oxaloacetate transaminase, simultaneously converting glutamate into aspartate .

  2. The oxoglutarate/isocitrate shuttle: This shuttle is essential for the exchange of reducing equivalents between compartments in the cell .

  3. Gluconeogenesis from lactate: SLC25A11 contributes to this process by facilitating the transport of necessary metabolites .

  4. Nitrogen metabolism: The carrier plays a significant role in nitrogen transport and utilization within the cell .

Maintenance of Mitochondrial Dynamics

Beyond its metabolic functions, SLC25A11 maintains mitochondrial fusion and fission events and the organization and morphology of cristae . This role in mitochondrial dynamics highlights the protein's importance beyond simple metabolite transport.

Regulation of Apoptosis

SLC25A11 is involved in the regulation of apoptosis and has been identified as a potential tumor-suppressor gene . The carrier has been reported to bind anti-apoptotic proteins Bcl-2 and Bcl-XL, and knockdown of SLC25A11 induced apoptosis in mouse insulinoma cells and Caenorhabditis elegans . Moreover, association of Bcl2 with SLC25A11 increased mitochondrial GSH accumulation, which may account for some of its cytoprotective actions .

Role in Glutathione Transport

SLC25A11 contributes to the mitochondrial uptake of glutathione (GSH). Blockade of the carrier with phenylsuccinate decreases mitochondrial GSH levels by 40–50%, demonstrating its significance in maintaining mitochondrial redox balance .

Contribution to Glucose-Stimulated Insulin Secretion

Research suggests that SLC25A11 may play a role in glucose-stimulated insulin secretion, as siRNA-mediated knockdown of the carrier reduced insulin release in both β-cells and isolated pancreatic islets .

Purification Strategies

Purification of recombinant bovine SLC25A11 typically involves:

  1. Detergent solubilization of membranes containing the expressed protein

  2. Affinity chromatography using tags incorporated into the recombinant protein

  3. Size exclusion chromatography for final purification

Functional Reconstitution

For functional studies, recombinant SLC25A11 is often reconstituted into liposomes or other membrane mimetics that provide an environment similar to the native mitochondrial inner membrane.

Inhibitors and Modulators

Several compounds have been identified as inhibitors of SLC25A11:

  1. Phenylsuccinate: Acts as a competitive inhibitor by binding to the substrate-binding site

  2. Pyridoxal 5′-phosphate (PLP): Inhibits carrier function through chemical modification

  3. Phthalonate: Interferes with substrate binding and transport

  4. Retinoic acid: Modulates carrier activity through direct interaction

Table 1: Known Inhibitors of Bovine SLC25A11

InhibitorMechanism of ActionEffect on Transport
PhenylsuccinateCompetitive bindingBlocks malate/oxoglutarate exchange
Pyridoxal 5′-phosphateChemical modificationInhibits carrier function
PhthalonateSubstrate binding interferenceReduces transport activity
Retinoic acidDirect interactionModulates carrier function

Regulatory Interactions

SLC25A11 function is regulated through several mechanisms:

  1. Allosteric regulation: Binding of succinate to the matrix side of the carrier increases the affinity for malate

  2. Protein-protein interactions: The carrier binds anti-apoptotic proteins Bcl-2 and Bcl-XL, which may modulate its function

  3. Post-translational modifications: Though not extensively characterized for bovine SLC25A11, these modifications likely play a role in regulating carrier function

Evolutionary Relationships

Comparison of the SLC25A11 protein sequence with other mitochondrial carrier proteins reveals that all contain a 3-fold repeated sequence of about 100 amino acids in length, and all the repeats are interrelated . This suggests that members of this family of proteins have similar structures and mechanisms and that they evolved from a common origin .

Functional Conservation

The transport mechanism of SLC25A11, involving alternating access of the substrate-binding site to either side of the membrane, is conserved across the SLC25 family . This functional conservation highlights the fundamental importance of this mechanism for mitochondrial carrier proteins.

Research Applications

Recombinant bovine SLC25A11 serves as a valuable tool for:

  1. Studying mitochondrial transport mechanisms

  2. Investigating metabolic disorders related to mitochondrial dysfunction

  3. Examining the role of mitochondrial carriers in cell death and survival

  4. Developing inhibitors and modulators of mitochondrial metabolism

Biotechnological Potential

The recombinant protein has potential applications in:

  1. Development of biosensors for metabolic monitoring

  2. Creation of artificial organelles for biotechnological applications

  3. Drug screening platforms targeting mitochondrial metabolism

Role in Disease

Further investigation into the role of SLC25A11 in metabolic disorders, cancer, and neurodegenerative diseases represents an important area for future research.

Therapeutic Targeting

The development of specific modulators of SLC25A11 function could open new therapeutic avenues for diseases involving mitochondrial dysfunction.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A11; SLC20A4; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-314
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
SLC25A11
Target Protein Sequence
AATASPGASGMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREY KTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG
Uniprot No.

Target Background

Function
This protein catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids. It plays a crucial role in various metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, gluconeogenesis from lactate, and nitrogen metabolism. This protein also maintains mitochondrial fusion and fission events, and the organization and morphology of cristae. It is involved in the regulation of apoptosis.
Gene References Into Functions
  1. Research findings describe the functional and structural role of amino acid residues in the odd-numbered transmembrane alpha-helices of the bovine mitochondrial oxoglutarate carrier. PMID: 17442340
  2. Linewidth analysis, correlated to local probe mobility, indicates a well-defined periodicity of the whole segment from G281 to I298, suggesting an alpha-helical structure. PMID: 18428039
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Heart, liver and brain.

Q&A

What is the basic function of SLC25A11 in cellular metabolism?

SLC25A11, also known as the mitochondrial 2-oxoglutarate/malate carrier protein or OGCP, catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids. This transport function is essential for several key metabolic processes, including:

  • The malate-aspartate shuttle (facilitating NADH transport from cytosol to mitochondria)

  • The oxoglutarate/isocitrate shuttle

  • Gluconeogenesis from lactate

  • Nitrogen metabolism

The protein plays a critical role in cellular energy production by facilitating the movement of reducing equivalents between cellular compartments, which is essential for ATP synthesis through oxidative phosphorylation .

What is the structure and sequence length of the bovine SLC25A11 protein?

The bovine 2-oxoglutarate/malate carrier protein sequence has been deduced from overlapping cDNA clones. The protein sequence, including the initiator methionine, is 314 amino acids long. The mature protein has a modified alpha-amino group, although the precise nature of this modification and the exact position of the mature N-terminal amino acid have not been definitively established, though it likely lies within amino acids 1-4 of the deduced protein sequence .

Structural analysis indicates that SLC25A11, like other mitochondrial carrier proteins, contains a characteristic three-fold repeated sequence of approximately 100 amino acids in length. The distribution of hydrophobic amino acids suggests that these domains fold into similar structural motifs, possibly consisting of two transmembrane alpha-helices connected by an extensive extramembranous hydrophilic region .

How is SLC25A11 related to other mitochondrial carrier proteins?

Comparative sequence analysis reveals that SLC25A11 shares structural similarities with other mitochondrial carrier proteins, including:

  • ADP/ATP translocase

  • The phosphate carrier

  • The uncoupling protein from brown fat

All four proteins contain a three-fold repeated sequence of about 100 amino acids, and all these repeats are interrelated. This structural similarity suggests that members of this carrier protein family share similar mechanisms and have evolved from a common ancestral origin .

The common structural motifs across the mitochondrial carrier family indicate a conserved functional mechanism for metabolite transport across the inner mitochondrial membrane, despite the different substrates handled by individual family members .

What are the optimal methods for studying SLC25A11 expression and function?

Several methodological approaches can be employed to study SLC25A11 expression and function:

Protein Expression Analysis:

  • Western blotting with specific SLC25A11 antibodies

  • Immunofluorescence for cellular localization

  • qRT-PCR for mRNA expression analysis

Functional Analysis:

  • Transport assays using reconstituted proteoliposomes

  • Mitochondrial isolation and respirometry

  • Metabolite analysis using mass spectrometry or NMR

For mitochondrial isolation specifically:

  • Harvest cells (approximately 2×10^7 cells)

  • Lyse cells in Mitochondria Isolation Reagent A

  • Add Reagent B and vortex at maximum speed for 5 seconds

  • Incubate on ice for 5 minutes, vortexing at maximum speed every minute

  • Add 800 μL of Mitochondria Isolation Reagent C and mix by inversion

  • Centrifuge at 700 × g for 10 minutes at 4°C

  • Collect supernatant and centrifuge at 12,000 × g for 15 minutes at 4°C

  • Wash the mitochondrial pellet and centrifuge again at 12,000 × g for 15 minutes at 4°C

  • Collect the pellet as the mitochondrial fraction

This protocol allows for the separation of mitochondrial and cytosolic fractions, enabling the study of SLC25A11 localization and function in specific cellular compartments.

What experimental approaches are used to knock down or knock out SLC25A11 in research models?

Several approaches have been documented for manipulating SLC25A11 expression:

siRNA-mediated knockdown:

  • Transient knockdown using specific siRNA sequences targeting SLC25A11

  • Typically achieves 50-100% reduction in colony formation in cancer cell lines

shRNA-mediated knockdown:

  • More stable, long-term knockdown using shRNA constructs

  • Similar efficacy to siRNA in reducing colony formation

CRISPR-Cas9 knockout:
For generating SLC25A11 knockout mouse models:

  • Prepare a mixture of Cas9 protein (100 ng/μl) and guide RNA (50 ng/μl)

  • Inject the mixture into the cytoplasm of pronuclei

  • Use specific sgRNA sequences (e.g., 5'-ACTGCATCCGGTTCTTCACC-3' and 5'-CGGATGCAGTTGAGTGGTGA-3')

  • Identify indel mutations in F1 mice after TA cloning and sequencing

Verification methods:

  • Western blotting to confirm protein reduction

  • qRT-PCR to verify mRNA knockdown

  • Functional assays to assess metabolic impact

How can researchers assess the effects of SLC25A11 knockdown on cell viability and metabolism?

Multiple assays can be employed to evaluate the consequences of SLC25A11 manipulation:

Cell Viability and Proliferation:

  • Clonogenic assay:

    • Plate 1,000-5,000 cells per well in 6-well plates

    • Allow colony formation for 14 days without changing media

    • Stain colonies with 0.005% crystal violet solution

    • Quantify colony number and size

  • Apoptosis detection:

    • Collect cells after SLC25A11 siRNA treatment

    • Wash with cold PBS and resuspend in binding buffer

    • Add Annexin V-FITC and PI

    • Analyze by flow cytometry

Metabolic Assessment:

  • ATP measurement assays

  • NAD+/NADH ratio determination

  • Oxygen consumption rate (OCR) measurements

  • Extracellular acidification rate (ECAR) analysis

  • Metabolite profiling using mass spectrometry

Assay TypeParameters MeasuredRelevance to SLC25A11 Function
Clonogenic AssayColony formation capacityLong-term proliferative potential
Flow CytometryApoptotic/viable cell populationsCell death mechanisms
ATP AssayCellular ATP levelsEnergy production capacity
NAD+/NADH RatioRedox stateShuttle function efficiency
RespirometryOxygen consumptionMitochondrial function
MetabolomicsMetabolite levelsPathway flux alterations

What is the role of SLC25A11 in cancer metabolism and how can it be exploited therapeutically?

SLC25A11 plays a critical role in cancer cell metabolism, particularly in non-small cell lung cancer (NSCLC) and melanoma. Research findings include:

Cancer-specific metabolic dependency:

  • Cancer cells exhibit a higher cytosolic to mitochondrial NADH ratio compared to normal cells

  • This is consistent with elevated levels of SLC25A11 in cancer cells

  • The mitochondrial electron transport chain remains functionally active in cancer cells

SLC25A11 inhibition effects:

  • Blocking malate transport through SLC25A11 knockdown significantly impairs ATP production

  • This inhibition selectively affects cancer cell growth with minimal impact on normal cells

  • SLC25A11 knockdown reduces colony formation by 50-100% in various cancer cell lines

Mechanism of action:

  • Cancer cells critically depend on SLC25A11 for transporting NADH from cytosol to mitochondria in the form of malate

  • This transport is essential for ATP production through oxidative phosphorylation

  • Blocking SLC25A11 reduces ATP production, thereby inhibiting cancer growth

In vivo validation:

  • Heterozygous SLC25A11 knockout mice show suppressed KRAS^LA2 lung tumor formation

  • This provides proof-of-concept for targeting SLC25A11 in cancer therapy

How does SLC25A11 function in the malate-aspartate shuttle, and what are the implications for cellular energy production?

The malate-aspartate shuttle is a crucial mechanism for transferring reducing equivalents (NADH) from the cytosol to mitochondria, and SLC25A11 plays a central role in this process:

Shuttle mechanism:

  • Cytosolic NADH reduces oxaloacetate to malate via cytosolic malate dehydrogenase

  • Malate enters the mitochondria in exchange for 2-oxoglutarate via SLC25A11

  • Inside mitochondria, malate is oxidized back to oxaloacetate, generating mitochondrial NADH

  • Oxaloacetate is transaminated to aspartate, which exits the mitochondria

  • In the cytosol, aspartate is converted back to oxaloacetate, completing the cycle

Implications for energy production:

  • This shuttle effectively transfers reducing equivalents from cytosolic NADH to mitochondrial NADH

  • Mitochondrial NADH feeds into the electron transport chain for ATP production

  • Cancer cells show heightened dependence on this shuttle for ATP generation compared to normal cells

Metabolic measurements:
Studies examining the cytosolic to mitochondrial NADH ratio in cancer versus normal cells reveal significant differences:

Cell TypeCytosolic:Mitochondrial NADH RatioSLC25A11 Expression Level
Normal CellsLower (baseline)Normal (baseline)
NSCLC CellsHigherElevated
Melanoma CellsHigherElevated

These findings suggest that cancer cells have adapted to utilize the malate-aspartate shuttle more extensively for their energy needs, making SLC25A11 a promising target for cancer therapy .

What experimental design considerations are crucial when studying SLC25A11 in different disease models?

When designing experiments to study SLC25A11 in disease models, researchers should consider several critical factors:

Variable definition and control:

  • Clearly define independent variables (e.g., SLC25A11 expression levels) and dependent variables (e.g., ATP production, cell growth)

  • Control variables should be rigorously maintained across experimental conditions

  • Identify potential confounding variables that might influence results

Cell type selection:

  • Include both cancer and normal cell lines for comparative studies

  • Consider tissue-specific expression patterns of SLC25A11

  • Use multiple cell lines representing the same cancer type to account for heterogeneity

In vivo model considerations:

  • Consider heterozygous versus homozygous knockout models

  • Tissue-specific conditional knockout may be preferable to avoid developmental effects

  • Age, sex, and genetic background of animal models must be carefully controlled

Measurement parameters:

  • ATP production (primary outcome in many SLC25A11 studies)

  • NADH/NAD+ ratios in different cellular compartments

  • Oxygen consumption rate

  • Cell proliferation and apoptosis markers

  • Metabolite profiling

Experimental design types:

  • Within-subjects design: Useful for measuring changes in the same cellular population before and after SLC25A11 manipulation

  • Between-subjects design: Comparing different cell lines or animal models with varying SLC25A11 expression levels

Controls and validation:

  • Include scrambled siRNA controls for knockdown experiments

  • Perform rescue experiments by reintroducing wild-type SLC25A11

  • Validate findings across multiple experimental approaches and model systems

What are common challenges in recombinant SLC25A11 protein expression and purification?

Researchers working with recombinant SLC25A11 often encounter several challenges:

Protein solubility issues:

  • As a multi-pass membrane protein, SLC25A11 can form inclusion bodies during bacterial expression

  • Solution: Use mild detergents like DDM or LDAO during extraction and purification

  • Alternative: Consider mammalian or insect cell expression systems for better folding

Maintaining native conformation:

  • Mitochondrial carrier proteins can lose functional conformation during purification

  • Solution: Optimize buffer conditions (pH, salt concentration, glycerol percentage)

  • Consider nanodiscs or liposomes for maintaining native-like membrane environment

Functional validation:

  • Confirming that purified protein retains transport activity is challenging

  • Solution: Develop reconstitution assays in proteoliposomes with appropriate substrates

  • Use fluorescent probes or radioisotope-labeled substrates to measure transport activity

Expression optimization strategies:

  • Test different fusion tags (His, GST, MBP) for improved solubility and purification

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider codon optimization for the expression system being used

How can researchers address data inconsistencies when studying SLC25A11 in different experimental systems?

When faced with inconsistent results across different experimental systems:

Methodological standardization:

  • Establish detailed protocols for all experimental procedures

  • Standardize reagents, antibodies, and cell passage numbers

  • Use consistent data analysis methods and statistical approaches

System-specific considerations:

  • Cell line authentication to ensure genetic identity

  • Account for differences in endogenous SLC25A11 expression levels

  • Consider compensatory mechanisms that may activate in certain systems

Troubleshooting steps for inconsistent knockdown effects:

  • Verify knockdown efficiency at both protein and mRNA levels

  • Examine expression of other mitochondrial carriers that might compensate

  • Assess cell-specific metabolic profiles to understand differential dependencies

  • Consider the impact of culture conditions on metabolic states

Data reconciliation approaches:

  • Meta-analysis of multiple experimental datasets

  • Cross-validation using complementary techniques

  • Development of mathematical models to explain system-specific differences

What are the emerging research questions regarding SLC25A11's role beyond traditional metabolic pathways?

Several promising research directions are emerging:

Redox regulation:

  • SLC25A11 may interact with glutathione transport systems

  • Potential role in cellular response to oxidative stress

  • Connection to Bcl-2 in coordinating mitochondrial glutathione pool enhancement

Signal transduction:

  • Potential involvement in metabolic signaling pathways

  • Interactions with other cellular components beyond direct transport function

  • Role in sensing and responding to cellular energy status

Developmental biology:

  • Function during embryonic development and differentiation

  • Tissue-specific roles in specialized metabolic niches

  • Potential developmental defects in knockout models

Therapeutic targeting:

  • Development of specific inhibitors for cancer therapy

  • Structure-based drug design targeting SLC25A11 transport function

  • Combination approaches with other metabolic pathway inhibitors

How can advanced techniques like CRISPR screening and metabolomics advance our understanding of SLC25A11 function?

Integration of cutting-edge technologies offers new opportunities:

CRISPR-based approaches:

  • Genome-wide synthetic lethality screens to identify genes that, when co-deleted with SLC25A11, cause cell death

  • CRISPRi/CRISPRa for reversible modulation of SLC25A11 expression

  • Base editing for introducing specific point mutations to study structure-function relationships

Metabolomics integration:

  • Untargeted metabolomics to identify novel metabolites affected by SLC25A11 manipulation

  • Flux analysis using isotope labeling to track metabolic pathway alterations

  • Integration with transcriptomics and proteomics for systems-level understanding

Single-cell technologies:

  • Single-cell metabolomics to understand cellular heterogeneity in response to SLC25A11 inhibition

  • Spatial transcriptomics to map SLC25A11 expression in tissue microenvironments

  • Live-cell imaging with metabolic sensors to track real-time changes

Computational approaches:

  • Machine learning for predicting cellular responses to SLC25A11 modulation

  • Metabolic modeling to simulate the impact of SLC25A11 inhibition on cellular metabolism

  • Network analysis to identify key interaction partners and regulatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.