Recombinant Bovine Mitochondrial carrier homolog 2 (MTCH2)

Shipped with Ice Packs
In Stock

Description

Biological Relevance of MTCH2

While recombinant bovine MTCH2 is a research tool, its biological significance is anchored in MTCH2’s roles in mitochondrial dynamics, apoptosis, and metabolism:

Apoptosis and Mitochondrial Dynamics

  • MTCH2 acts as a receptor for truncated BID (tBID), facilitating its recruitment to the mitochondrial outer membrane (MOM) during apoptosis .

  • It regulates mitochondrial fusion via interactions with proteins like MFN2, influencing mitochondrial morphology and function .

Metabolic Regulation

  • MTCH2 modulates energy expenditure and lipid metabolism. Its loss increases mitochondrial oxidative activity, elevates ATP demand, and impairs adipocyte differentiation .

  • In C. elegans and zebrafish models, MTCH2 depletion reduces lipid storage, highlighting its conserved role in metabolic homeostasis .

Research Applications

Recombinant Bovine MTCH2 is employed in:

  1. Structural Studies:

    • Mapping binding interfaces with tBID or other apoptosis-related proteins .

    • Characterizing conformational changes via X-ray crystallography or NMR .

  2. Functional Assays:

    • Mitochondrial Fusion/Fission: Co-expressing MTCH2-GFP in knockout models rescues mitochondrial elongation .

    • Apoptosis: Testing tBID recruitment efficiency in vitro .

  3. Metabolic Profiling:

    • Analyzing lipid reprogramming (e.g., membrane vs. storage lipids) in MTCH2-deficient cells .

Comparative Analysis: MTCH2 Across Species

Recombinant bovine MTCH2 shares high sequence homology with human MTCH2, enabling cross-species functional insights. Below is a comparison of key properties:

FeatureBovine MTCH2Human MTCH2
Subcellular LocalizationOuter mitochondrial membraneOuter mitochondrial membrane
Primary FunctionApoptosis, mitochondrial fusionApoptosis, metabolism regulation
Interacting PartnerstBID, MFN2, DRP1tBID, MFN2, DRP1

Challenges and Considerations

  • Conformational Stability: The recombinant protein’s His-tag may alter structural dynamics compared to endogenous MTCH2 .

  • Species-Specific Variations: Bovine MTCH2’s lipid metabolism roles may differ from human or murine models .

Future Directions

  1. Therapeutic Targeting: Peptides mimicking MTCH2-tBID binding sites could inhibit apoptosis in cancer cells .

  2. Metabolic Diseases: Exploring MTCH2’s role in obesity and diabetes using bovine models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
MTCH2; Mitochondrial carrier homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
MTCH2
Target Protein Sequence
ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLAPTVGRNIFGRQVCQLPGLFCYAQHI ASIDGKRGLFTGLTPRLCSGILGTVVHGKVLQHYQECDKAEESGSGNVQKEVSSSFDRVI KETTREMMARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIATIYREEGILGFFAG LIPRLLGDIISLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVS NLMAVNNCGLAGGCPPYAPIYSSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLRM LI
Uniprot No.

Target Background

Function
Mitochondrial depolarization is induced; the specific transported substrate remains unidentified.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary conservation pattern of MTCH2 across species including bovine models?

MTCH2 is highly conserved across species, being present in all examined multicellular Metazoa as well as unicellular Choanoflagellata. Sequence analysis confirms that MTCH2 is a highly derived member of the mitochondrial carrier family, with notable differences from other family members that likely explain its specialized functions . While most mitochondrial carriers are located in the inner mitochondrial membrane, MTCH2 uniquely localizes to the outer mitochondrial membrane, suggesting functional adaptation over evolutionary time. In bovine models, the protein maintains high sequence homology with human and murine variants, making findings from rodent studies largely applicable to bovine research.

How does MTCH2 differ structurally and functionally from other mitochondrial carrier proteins?

MTCH2 displays extensive sequence differences compared to other mitochondrial carrier proteins, which typically function as monomeric transporters exchanging small substrates between the mitochondrial matrix and intermembrane space . Unlike typical carriers that reside in the inner mitochondrial membrane, MTCH2 is an integral protein of the outer mitochondrial membrane . Functionally, MTCH2 has evolved beyond the ancestral transport role and now serves as both a protein insertase for α-helical mitochondrial outer membrane proteins and as a receptor-like protein for tBID during apoptotic signaling . This functional duality makes MTCH2 unique among mitochondrial carriers and suggests its original transport function has been co-opted by the apoptotic machinery to provide a receptor and signaling mechanism.

What methods are most effective for producing functional recombinant bovine MTCH2?

For producing functional recombinant bovine MTCH2, a bacterial expression system using E. coli with a mild induction protocol (0.1-0.5 mM IPTG at 18°C overnight) is recommended to prevent inclusion body formation. The protein should be expressed with a cleavable N-terminal tag (His6 or GST) rather than C-terminal modifications that might interfere with membrane insertion. Purification should employ detergent screening (starting with mild detergents like DDM or CHAPS) to maintain the native conformation. Functionality verification requires reconstitution into liposomes followed by in vitro insertion assays using tail-anchored proteins as substrates. For recombinant expression in mammalian systems, lentiviral vectors with tetracycline-inducible promoters provide better control of expression levels, crucial for preventing artifacts from overexpression.

How does recombinant bovine MTCH2 influence mitochondrial dynamics in different cell types?

Recombinant bovine MTCH2 serves as a direct regulator of mitochondrial fusion/elongation across cell types. In mouse embryonic fibroblasts (MEFs) and embryonic stem cells (ESCs), MTCH2 deletion results in fragmented, less-elongated mitochondria with impaired fusion capacity . This phenotype can be rescued by re-expression of MTCH2 or by expression of mitofusin 2 (MFN2), a critical regulator of mitochondrial fusion . Quantitative analysis using aspect ratio calculations, sphericity measurements, and fusion assays demonstrates that MTCH2 significantly impacts mitochondrial morphology. The impact on bovine cells would be expected to follow similar patterns, given the conservation of mitochondrial dynamics machinery across mammalian species. When studying bovine cells, researchers should employ time-lapse confocal microscopy with mitochondria-targeted fluorophores to quantify fusion events in the presence and absence of recombinant MTCH2.

What is the relationship between MTCH2's dual roles in apoptosis regulation and protein insertion?

MTCH2 exhibits a fascinating evolutionary adaptation where its ancestral carrier function has evolved into dual specialized roles. As both an insertase for α-helical proteins in the mitochondrial outer membrane and as a receptor for tBID during apoptotic signaling , MTCH2 represents a molecular link between mitochondrial biogenesis and cell death pathways. This relationship creates a mechanistic paradox where MTCH2 facilitates insertion of both pro-survival and pro-apoptotic proteins. The balance between these functions appears context-dependent, as MTCH2 overexpression can either promote or inhibit apoptosis depending on the cell type and stimulus .

When studying recombinant bovine MTCH2, researchers should design experiments that can distinguish between these functions, such as using mutants that selectively disrupt tBID binding while preserving insertase activity. Additionally, temporal analysis of MTCH2 function during stress responses can reveal how these dual roles are coordinated during physiological and pathological conditions.

How does MTCH2 coordinate with other insertase machinery in the mitochondrial outer membrane?

To study the coordination between recombinant bovine MTCH2 and other insertion machinery, researchers should employ:

  • Co-immunoprecipitation studies to identify interaction partners

  • Blue-native PAGE to characterize native protein complexes (MTCH2 resides in a ~185 kDa complex in viable cells )

  • In vitro reconstitution assays comparing insertion efficiency of various substrates with purified components

  • Crosslinking approaches using photo-activatable amino acids to capture transient interactions during the insertion process

What cellular assays best capture MTCH2's role in mitochondrial morphology and function?

To effectively study MTCH2's impact on mitochondrial morphology and function, researchers should implement the following methodological approaches:

  • Morphological analysis: Employ confocal microscopy with mitochondria-targeted fluorophores (MitoTracker) combined with computational analysis of:

    • Aspect ratio (measure of elongation)

    • Sphericity (3D structural analysis)

    • Morphological classification (networked, intermediate, fragmented)

  • Fusion assays: Utilize photoactivatable or photoconvertible fluorescent proteins targeted to mitochondria (PhAM; green-to-red) to track mitochondrial fusion rates in real-time .

  • Mitochondrial function assessment:

    • Measure mtDNA copy number using qPCR

    • Assess mitochondrial respiration with oxygen consumption rate (OCR) analysis

    • Evaluate membrane potential with potentiometric dyes (TMRM, JC-1)

  • Protein complex analysis: Use blue-native gel electrophoresis to identify MTCH2-containing complexes (~185 kDa) and track recruitment of interaction partners like tBID and BAX following apoptotic stimuli .

When working with recombinant bovine MTCH2, these assays should be adapted to bovine cell lines or primary cells to account for species-specific differences in mitochondrial physiology.

What are the critical controls needed when studying recombinant MTCH2 in reconstitution experiments?

For valid reconstitution experiments with recombinant bovine MTCH2, the following controls are essential:

  • Protein functionality controls:

    • Proper folding verification through circular dichroism

    • Activity controls comparing wild-type MTCH2 to known non-functional mutants

    • Dose-dependent response curves to establish specific activity

  • Reconstitution system controls:

    • Empty liposomes/membranes without MTCH2

    • Heat-inactivated MTCH2 preparations

    • Size-matched control proteins with similar physicochemical properties

    • Reconstitution with MTCH2 from different species to assess conservation of function

  • Substrate specificity controls:

    • Non-MTCH2 dependent mitochondrial proteins (e.g., β-barrel proteins like VDAC1)

    • Inner membrane proteins (e.g., CYC1) that should not be affected by MTCH2

    • Cytosolic proteins to test for non-specific membrane association

  • Physiological relevance controls:

    • Comparison of in vitro insertion efficiency with in vivo steady-state levels

    • Rescue experiments in MTCH2-depleted cells to confirm functional reconstitution

These controls ensure that observed effects are specifically attributable to MTCH2's intrinsic activity rather than experimental artifacts.

How should researchers interpret conflicting data regarding MTCH2's effects on mitochondrial function?

Conflicting data regarding MTCH2's effects on mitochondrial function require careful analysis of experimental context. For instance, while MTCH2 deletion in embryonic stem cells (ESCs) leads to decreased mitochondrial respiration , the same deletion in hematopoietic stem cells (HSCs) and skeletal muscle cells results in increased respiration . This apparent contradiction can be resolved by understanding the temporal dynamics of compensatory mechanisms.

To properly interpret such conflicts, researchers should:

  • Consider developmental stage: MTCH2's effects may differ between pluripotent and differentiated cells due to metabolic rewiring during development.

  • Examine acute vs. chronic effects: Initial deletion likely decreases function, while compensatory mechanisms may emerge over time in surviving cells.

  • Analyze tissue-specific contexts: Different cell types have distinct metabolic requirements and mitochondrial regulatory networks.

  • Implement time-course experiments: Track mitochondrial parameters at multiple time points following MTCH2 manipulation.

  • Verify protein levels of other mitochondrial regulators: Check for compensatory changes in expression of fusion/fission proteins and respiratory chain components.

When working with bovine MTCH2, researchers should be particularly attentive to species-specific metabolic adaptations that might influence these compensatory responses.

What statistical approaches are most appropriate for analyzing MTCH2's impact on diverse mitochondrial parameters?

For robust analysis of MTCH2's impact on mitochondrial parameters, the following statistical approaches are recommended:

ParameterStatistical ApproachSample Size RecommendationNotes
Mitochondrial morphologyNon-parametric tests (Mann-Whitney)n ≥ 100 mitochondria from ≥30 cellsCell-to-cell variability requires hierarchical analysis
Fusion rateRepeated measures ANOVAn ≥ 20 fusion events per conditionTime-dependent processes require longitudinal statistics
mtDNA copy numberStudent's t-test or ANOVA with post-hoc testsn ≥ 6 biological replicatesLog-transformation may be needed for normality
RespirationMixed-effects modelsn ≥ 8 replicates per conditionAccount for both technical and biological variation
Protein complex formationDensity-based analysis with bootstrap resamplingn ≥ 3 independent experimentsNon-linear relationships require specialized approaches
Insertion efficiencyNon-linear regressionDose-response curves with ≥5 concentrationsEC50 values provide quantitative comparison metrics

For all analyses, researchers should consider biological relevance alongside statistical significance, using effect size calculations (Cohen's d, η²) to determine the magnitude of MTCH2's impact. When comparing bovine MTCH2 to other species, homogeneity of variance should be confirmed before applying parametric tests.

How can CRISPR-based approaches be optimized for studying MTCH2 function in bovine cell models?

CRISPR-based approaches for studying bovine MTCH2 require careful optimization due to the embryonic lethality observed in complete knockout models . Instead of complete ablation, researchers should implement:

  • Inducible CRISPR systems: Use doxycycline-inducible Cas9 or Cas12a with MTCH2-targeting guide RNAs to control the timing and extent of deletion.

  • Domain-specific editing: Design precise mutations targeting functional domains rather than complete gene disruption:

    • tBID binding site modifications to specifically disrupt apoptotic function

    • Insertase domain alterations to affect protein biogenesis function

    • Dimerization interface mutations to study complex formation

  • Knock-in strategies:

    • Introduce fluorescent tags at endogenous loci using homology-directed repair

    • Create bovine cell lines with photo-activatable/convertible mitochondria for fusion assays

    • Generate epitope-tagged versions for efficient immunoprecipitation

  • Guide RNA design considerations:

    • Bovine-specific PAM site analysis for optimal targeting

    • Off-target prediction accounting for the bovine genome

    • Verification of editing efficiency using deep sequencing

  • Phenotypic rescue controls:

    • Complementation with recombinant wild-type bovine MTCH2

    • Complementation with MTCH2 from other species to assess functional conservation

    • Structure-function analysis with chimeric proteins

These approaches enable more nuanced investigation of MTCH2 function while avoiding the limitations of complete knockout models.

What are the key considerations when studying MTCH2-dependent protein insertion mechanisms using in vitro systems?

When investigating MTCH2-dependent protein insertion mechanisms with in vitro systems, researchers should consider:

  • Reconstitution system design:

    • Lipid composition should mimic the mitochondrial outer membrane (high phosphatidylcholine, presence of cardiolipin)

    • Membrane curvature influences insertion efficiency and should be controlled

    • Temperature and pH must reflect physiological conditions (37°C for mammalian systems)

  • Substrate preparation:

    • Use cell-free translation systems (rabbit reticulocyte lysate) to generate nascent substrates

    • Consider co-translational vs. post-translational insertion mechanisms

    • Prepare multiple substrate types (TA proteins, signal-anchored proteins, multipass proteins)

  • Insertion assessment methods:

    • Protease protection assays to determine membrane integration

    • Carbonate extraction to distinguish peripheral from integral membrane proteins

    • Fluorescence-based real-time insertion monitoring

  • Interaction analysis:

    • Incorporate photo-crosslinkable amino acids (BpA) at different positions in substrate proteins

    • Purify crosslinked species using affinity tags for mass spectrometry analysis

    • Map interaction interfaces through systematic mutational analysis

  • Kinetic evaluation:

    • Measure association and insertion rates under various conditions

    • Determine substrate concentration dependence and saturation kinetics

    • Assess competition between different substrates

These methodological considerations enable rigorous characterization of MTCH2's insertase function and provide mechanistic insights applicable to bovine mitochondrial biology.

How do the functional properties of bovine MTCH2 compare to human and murine orthologs?

  • Substrate specificity profiles: While the core mechanism of α-helical protein insertion is likely conserved, bovine MTCH2 may show preferences for certain substrates based on subtle sequence variations in the binding interface.

  • Regulatory mechanisms: Post-translational modifications may differ between species, affecting activity regulation. Phosphorylation sites and other modification patterns should be compared through mass spectrometry analysis.

  • Complex formation: The ~185 kDa complex containing MTCH2 observed in murine cells may have different composition or stability in bovine cells, reflecting adaptation to species-specific mitochondrial architecture.

  • Tissue expression patterns: While generally ubiquitous, relative expression levels across tissues may differ between species, reflecting metabolic adaptations particular to bovine physiology.

  • Interaction with apoptotic machinery: The binding affinity for tBID and subsequent recruitment of BAX may show species-specific differences that should be quantified through binding assays with purified components.

Comparative functional studies using recombinant MTCH2 from multiple species in the same experimental system can directly address these potential differences while controlling for experimental variables.

What methodological approaches are most effective for studying MTCH2's role in bovine pluripotent stem cells?

To effectively study MTCH2's role in bovine pluripotent stem cells (bPSCs), researchers should implement these specialized approaches:

  • Establishment of appropriate model systems:

    • Derive bovine embryonic stem cells under naive conditions (2i/LIF)

    • Generate bovine induced pluripotent stem cells (biPSCs) through defined factors

    • Establish embryonic stem cell lines from MTCH2-edited bovine embryos

  • Pluripotency transition analysis:

    • Track naïve-to-primed transition using bovine-specific markers

    • Monitor changes in mitochondrial morphology during state transitions using live-cell imaging

    • Assess metabolic rewiring through extracellular flux analysis

  • MTCH2 manipulation strategies:

    • Use inducible CRISPR systems for temporal control of MTCH2 deletion

    • Employ enforced expression of fusion regulators (MFN2, dominant-negative DRP1) to bypass MTCH2 requirement

    • Implement rescue experiments with wild-type and mutant MTCH2 variants

  • Developmental potential assessment:

    • Evaluate embryoid body formation efficiency and differentiation capacity

    • Assess contribution to chimeric embryos following blastocyst injection

    • Monitor teratoma formation capacity and differentiation into three germ layers

  • Integration with bovine developmental biology:

    • Connect findings to bovine pre-implantation development timeline

    • Compare with in vivo embryonic transitions at comparable developmental stages

    • Consider species-specific timing of pluripotency transitions

These approaches address the unique challenges of bovine stem cell research while leveraging findings from murine models where MTCH2 is known to regulate the naïve-to-primed pluripotency transition .

What emerging technologies could advance our understanding of MTCH2's multifunctional roles?

Emerging technologies with significant potential to advance MTCH2 research include:

  • Cryo-electron microscopy (Cryo-EM): Determination of MTCH2's high-resolution structure in native membrane environments will provide crucial insights into its dual functions in protein insertion and apoptotic signaling.

  • Proximity labeling proteomics: TurboID or APEX2 fusions with MTCH2 can map its dynamic interactome under different cellular conditions, revealing context-specific protein associations.

  • Single-molecule tracking: Following individual MTCH2 molecules in living cells can reveal dynamic behavior, complex formation, and substrate interactions at unprecedented resolution.

  • Organoid and 3D culture systems: Studying MTCH2 function in more physiologically relevant bovine organoid models will bridge the gap between cell culture and in vivo studies.

  • High-throughput CRISPR screening: Systematic identification of genetic modifiers of MTCH2 function through genome-wide or targeted screens can uncover regulatory networks.

  • Mitochondrial-targeted optogenetics: Light-controlled manipulation of MTCH2 activity or interactions will allow temporal precision in functional studies.

  • Multi-omics integration: Combining proteomics, metabolomics, and transcriptomics approaches to build comprehensive models of MTCH2's impact on cellular physiology.

These technologies applied to bovine systems will accelerate our understanding of MTCH2's roles beyond what conventional approaches have revealed.

How might MTCH2's functions be targeted for therapeutic applications in bovine health?

While primarily a research question, understanding MTCH2's functions has potential therapeutic applications for bovine health:

  • Reproductive biotechnology: Modulating MTCH2 activity could potentially enhance embryonic development success rates in assisted reproductive technologies for valuable bovine genetic lines.

  • Metabolic optimization: Given MTCH2's role in mitochondrial dynamics and function, targeted approaches could help optimize energy metabolism in production animals.

  • Cell stress resistance: Manipulation of MTCH2-dependent apoptotic pathways might enhance resilience to cellular stresses relevant to bovine health challenges.

  • Developmental programming: Transient modulation during critical developmental windows could influence long-term metabolic parameters with relevance to production efficiency.

  • Disease models: Bovine MTCH2 studies may provide insights applicable to human mitochondrial disorders due to the high conservation of this pathway.

To pursue these applications, researchers should focus on developing:

  • Small molecule modulators of MTCH2 activity

  • Peptide-based inhibitors of specific MTCH2 interactions

  • Targeted delivery systems for MTCH2-modulating compounds

  • Genetic strategies for conditional MTCH2 manipulation in specific tissues

Advancing from basic research to these applications requires rigorous validation in relevant bovine models with careful attention to specificity and safety considerations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.