Recombinant Bovine Mitochondrial import inner membrane translocase subunit Tim21 (TIMM21)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine Mitochondrial Import Inner Membrane Translocase Subunit Tim21 (TIMM21)

Recombinant Bovine Mitochondrial Import Inner Membrane Translocase Subunit Tim21 (TIMM21) refers to a specific variant of the TIMM21 protein, which is produced using recombinant DNA technology. TIMM21 is a component of the translocase of the inner mitochondrial membrane (TIM) . This complex is essential for importing proteins into the mitochondria, which are vital for cellular functions . TIMM21 may participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane .

Function and Role of TIMM21

TIMM21 is involved in the import of proteins into the mitochondrial matrix and inner membrane . Specifically, it forms part of the TIM23 complex, which mediates the import of presequence-containing proteins (preproteins) . The TIM23 complex has two configurations:

  • TIMM23 MOTOR: Drives protein import into the matrix using ATP .

  • TIMM23 SORT: Facilitates the insertion of precursors into the inner membrane .

TIMM21 plays a role in tethering to the outer membrane and initiating the insertion of proteins into the inner membrane . It interacts with other components, such as Tim50, to form the sorting and organization translocase (SORT) complex .

Homology and Evolutionary Aspects

The TIMM21 gene shares homology with the COA1 gene, which is involved in mitochondrial function . Despite limited sequence conservation, both proteins exhibit structural similarities and play roles in mitochondrial processes .

Clinical Significance and Research

Research indicates that TIMM21 is crucial for integrating subunits into respiratory-chain intermediates . Studies involving TIMM50 deficiencies have shown that while some mitochondrial proteins remain unaffected, others are significantly altered, indicating the selective impact of TIMM complex dysfunction on mitochondrial proteomes .

Experimental Evidence and Research Findings

  • Protein Interactions: TIMM21 interacts with other proteins, such as TIMM17 and TIMM23, to facilitate protein import .

  • Functional Studies: Research on yeast Tim21 has revealed its involvement in importing and inserting proteins into the inner membrane .

  • Impact of Deficiency: Studies on TIMM50, which interacts with TIMM21, showed varied effects on mitochondrial proteins, suggesting a complex regulatory mechanism .

Data

Table 1: Key Features of TIMM21

FeatureDescription
Gene NameTIMM21
AliasesC18orf55, TIM21-like protein
FunctionPart of the TIM23 complex, involved in protein import into mitochondria
LocationMitochondrial inner membrane
Homologous ProteinsCOA1
Associated ComplexesTIM23 complex (TIMM23 MOTOR, TIMM23 SORT)
Biological ProcessMitochondrial respiratory chain complex I assembly; mitochondrial respiratory chain complex IV assembly; protein import into mitochondrial matrix

Table 2: Examples of Proteins Unaffected by TIMM50 Mutation

Protein CategorySpecific Proteins
Calcium HomeostasisMICU2, SLC25A3, LETM1
Heme SynthesisPPOX, CPOX
Cardiolipin SynthesisHADHA
Fe-S Cluster BiosynthesisNFS1, GLRX5, ISCU
DetoxificationPRDX5, SOD2, ABHD10, GSTK1
Fatty Acid OxidationDECR1, ECHS1, ETFA
Amino Acid MetabolismPYCR1, ALDH18A1, HIBCH
TCA CycleACO2, DLST, IDH3B, OGDH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TIMM21; TIM21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-244
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TIMM21
Target Protein Sequence
PGKPWFLPHSVPHRACSQTEPRWRWGLQEQNTTARPRCIWGVTQRSIWTQVRSPQSAKED GSKQVSVHRSQGGETVLSTSQKVKEAGRDFTYLIVVLIGISITGGLFYTIFRELFSSSSP NKIYGKALEKCRSHPEVISVFGEPVKGYGEVTRRGRRQLVSFIEYKKDGLKHMRVKFYIQ GSEPGKQGTVHLEVKENPESGEYEFRYIFVELEPYSRTIVVEDNRS
Uniprot No.

Target Background

Function
This protein participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It's also essential for the assembly of mitochondrial respiratory chain complex I and complex IV as a component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex). It likely shuttles between the presequence translocase and respiratory-chain assembly intermediates, facilitating the incorporation of early nuclear-encoded subunits into these complexes.
Database Links

KEGG: bta:614633

STRING: 9913.ENSBTAP00000012777

UniGene: Bt.3260

Protein Families
TIM21 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the basic function of bovine TIMM21 in mitochondrial protein import?

Bovine TIMM21 (Mitochondrial import inner membrane translocase subunit Tim21) serves as a key component of the presequence translocase complex at the mitochondrial inner membrane. It functions as a dynamic modulator that interacts with other translocase components, particularly Tim50, in a signal-sensitive manner at the intermembrane space (IMS) side of the inner membrane . The primary role of TIMM21 is to facilitate the reorganization of the TIM23 complex during protein import processes. When presequence-containing precursor proteins interact with the import machinery, TIMM21 undergoes a conformational change that releases it from Tim50, which subsequently enables the recruitment of motor proteins necessary for matrix translocation . This signal-driven release of Tim21 from Tim50 is crucial for the transformation of the translocase from a sorting-competent form to a motor-associated form that can efficiently transport proteins into the mitochondrial matrix .

How does bovine TIMM21 differ structurally and functionally from TIMM21 in other species?

Bovine TIMM21 shares core structural domains with TIMM21 proteins across mammalian species, but displays specific sequence variations that may reflect adaptation to the unique metabolic demands of cattle. Research examining mitochondrial function across Bos species has identified significant evidence of positive selection in genes encoding components of the oxidative phosphorylation (OXPHOS) pathway, suggesting species-specific adaptations in the mitochondrial import machinery including TIMM21 . The bovine TIMM21 protein contains conserved interaction domains that mediate binding with Tim50 and other components of the presequence translocase, though subtle amino acid differences may influence the strength and specificity of these interactions. The functional significance of these species-specific variations remains an active area of investigation, particularly in the context of mitonuclear compatibility in hybrid cattle populations where evidence suggests evolutionary coadaptation between nuclear-encoded mitochondrial proteins and the mitochondrial genome .

How can researchers isolate and characterize recombinant bovine TIMM21?

Isolation and characterization of recombinant bovine TIMM21 typically follows a multi-step protocol beginning with gene cloning and expression. The bovine TIMM21 coding sequence should be PCR-amplified from bovine cDNA, followed by insertion into an appropriate expression vector containing an affinity tag (e.g., His-tag or GST-tag) to facilitate purification. The construct can then be transformed into a suitable expression system such as E. coli BL21(DE3) or a eukaryotic expression system when post-translational modifications are critical. Expression conditions must be optimized to maximize protein yield while minimizing inclusion body formation, typically involving adjustments to temperature, IPTG concentration, and induction duration. Purification of the recombinant protein is achieved through affinity chromatography followed by size exclusion chromatography to enhance purity. Characterization should include SDS-PAGE and Western blotting to confirm identity and size, circular dichroism (CD) spectroscopy to assess secondary structure, and dynamic light scattering to evaluate protein homogeneity. Functional assays should include interaction studies with known binding partners, particularly Tim50, using techniques such as co-immunoprecipitation or surface plasmon resonance . These approaches collectively provide a comprehensive characterization of the recombinant protein's structural and functional properties.

What experimental models are most suitable for studying bovine TIMM21 function?

The selection of experimental models for studying bovine TIMM21 function depends on the specific research questions being addressed. Cell-based models derived from bovine tissues, particularly those with high mitochondrial content such as cardiac or skeletal muscle cells, provide a native context for examining TIMM21 function. Primary bovine fibroblasts or established bovine cell lines (e.g., Madin-Darby Bovine Kidney cells) can be effectively used for overexpression or knockdown studies to assess TIMM21's role in mitochondrial protein import. For mechanistic studies of protein-protein interactions, reconstituted systems using purified components of the TIM23 complex can reveal specific binding dynamics between TIMM21 and its partners . Yeast models offer a complementary approach through heterologous expression of bovine TIMM21 in tim21Δ yeast strains, providing insights into functional conservation and specialized adaptations. For in vivo relevance, tissue samples from different cattle breeds with varying mitochondrial demands can be analyzed to correlate TIMM21 expression levels with physiological parameters. Research examining hybrid cattle populations with mixed taurine and zebu ancestry offers a unique opportunity to study TIMM21 in the context of mitonuclear compatibility, as these natural genetic mosaics provide insights into selection pressures on mitochondrial import machinery .

What are the essential controls needed when conducting experiments with recombinant bovine TIMM21?

Robust experimental design for recombinant bovine TIMM21 research requires implementation of multiple control measures to ensure validity and reproducibility. When performing in vitro binding assays with purified TIMM21, researchers should include both positive controls (known interacting partners like Tim50) and negative controls (unrelated proteins of similar size and charge characteristics) to establish specificity of observed interactions . For functional assays measuring protein import efficiency, comparison with wild-type TIMM21 is essential when studying mutant variants, while mock-transfected or empty vector controls are necessary for overexpression studies. When examining TIMM21's role in protein complex formation, researchers should validate antibody specificity through immunoprecipitation with pre-immune serum and verify the identity of co-precipitated proteins via mass spectrometry rather than relying solely on Western blotting. Temperature-dependent controls are particularly important for import assays, as conducting parallel experiments at 4°C can distinguish between binding and complete translocation events. When analyzing subcellular localization, co-staining with established mitochondrial markers confirms proper targeting, while fractionation controls using markers for different submitochondrial compartments establish the precise localization within the organelle. For studies examining ancestry patterns at the TIMM21 locus in hybrid cattle, appropriate reference populations of pure taurine and zebu ancestry are essential to accurately determine local ancestry and detect deviations from genome-wide patterns .

How does bovine TIMM21 participate in the signal-driven reorganization of the presequence translocase complex?

Bovine TIMM21 plays a sophisticated role in orchestrating the dynamic assembly of different functional states of the presequence translocase. Current research indicates that TIMM21 acts as a molecular switch that responds to the presence of presequence-containing precursor proteins at the mitochondrial import channel. In the resting state, TIMM21 maintains a stable interaction with the receptor protein Tim50 at the intermembrane space side of the inner membrane . Upon recognition of a presequence signal by Tim50, this interaction undergoes a conformational change that leads to TIMM21's dissociation from the Tim50 receptor complex . This signal-driven release event represents a critical decision point in the import pathway, as it initiates a cascade of reorganization within the translocase assembly. The dissociation of TIMM21 from Tim50 creates binding sites that enable the recruitment of Pam17, a component required for proper association of the motor complex (PAM) with the core translocase . This reorganization effectively transforms the translocase from a SORT (sorting) configuration capable of lateral membrane integration to a motor-associated form specialized for matrix translocation . The precise molecular mechanisms through which presequence signals trigger this TIMM21 release remain under investigation, but research suggests involvement of the IMS domain of the Tim23 channel, which may serve as a signal transducer between precursor recognition and TIMM21 dissociation .

What is the evidence for evolutionary selection pressure on bovine TIMM21 in the context of mitonuclear compatibility?

Analysis of bovine TIMM21 evolution reveals compelling evidence for selection pressure driven by mitonuclear compatibility requirements. High-resolution genomic studies of hybrid African cattle populations have demonstrated that nuclear genes encoding mitochondrially-targeted proteins, including components of the import machinery like TIMM21, show patterns of ancestry that deviate significantly from genome-wide averages . In populations with mixed Bos taurus (taurine) and Bos indicus (zebu) ancestry but exclusively taurine mitochondrial DNA, there is consistent enrichment of taurine ancestry at nuclear loci encoding mitochondrial proteins . This non-random pattern suggests strong functional constraints that maintain compatibility between nuclear and mitochondrial genomes. Examination of local ancestry across hybrid cattle genomes using MOSAIC algorithm analysis has revealed significant retention of taurine variants at mitochondrially-targeted nuclear genes, supporting the hypothesis of mitonuclear incompatibility between zebu nuclear genes and taurine mitochondrial genomes . The functional gene subset classified as "high-mito genes" (HMG), which includes TIMM21 and other proteins directly interacting with mtDNA-encoded components, shows particularly strong signals of ancestry deviation . These findings align with theoretical predictions of mitonuclear coadaptation, wherein proteins involved in intimate functional interactions with mitochondrial components experience stronger selective pressures to maintain compatibility. Further evidence comes from evolutionary analyses showing that multiple components of the mitochondrial import machinery contain signatures of positive selection in bovine lineages, reflecting adaptations to specific metabolic demands and environmental conditions experienced during cattle evolution and domestication .

How do post-translational modifications regulate bovine TIMM21 function in different physiological conditions?

Post-translational modifications (PTMs) of bovine TIMM21 constitute a sophisticated regulatory layer that enables dynamic modulation of mitochondrial protein import in response to changing physiological conditions. Research indicates that TIMM21 undergoes multiple types of PTMs including phosphorylation, acetylation, and potential ubiquitination, each serving distinct regulatory functions. Phosphorylation represents the most extensively characterized modification, with multiple serine and threonine residues identified as targets for kinases including casein kinase II and protein kinase A. These phosphorylation events appear to modulate TIMM21's binding affinity for partners like Tim50, potentially serving as a mechanism to adjust import efficiency in response to cellular energy status. Under conditions of high ATP availability and active metabolism, phosphorylation patterns may promote increased import capacity to support mitochondrial biogenesis. Acetylation of lysine residues in TIMM21 has been observed to fluctuate in response to nutrient availability, potentially linking mitochondrial protein import to metabolic status through sirtuins or other deacetylases. Ubiquitination likely governs TIMM21 turnover and quality control, with evidence suggesting increased ubiquitination under stress conditions to regulate the composition of the import machinery. In bovine-specific contexts, there is emerging evidence that TIMM21 PTMs may show tissue-specific patterns that reflect the unique metabolic demands of different cattle tissues. For example, cardiac and skeletal muscle, with their high energetic requirements, may maintain distinct TIMM21 modification profiles compared to tissues with lower mitochondrial content. The dynamic interplay between these various PTMs likely creates a sophisticated regulatory network that fine-tunes the import process according to the specific physiological demands experienced by different bovine tissues under various environmental and metabolic conditions.

What techniques are most effective for assessing bovine TIMM21 interactions with other components of the import machinery?

The investigation of bovine TIMM21 interactions with other mitochondrial import components requires a multi-faceted methodological approach combining both in vitro and in vivo techniques. Co-immunoprecipitation (Co-IP) represents a fundamental method wherein antibodies against bovine TIMM21 are used to pull down protein complexes from mitochondrial extracts, followed by Western blotting or mass spectrometry to identify interacting partners . This approach is particularly valuable for detecting native interactions but should be complemented with reciprocal Co-IPs using antibodies against suspected binding partners like Tim50 to confirm specificity. For quantitative assessment of binding kinetics, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified recombinant proteins provides precise measurement of association and dissociation constants, revealing how factors like presequence peptides modify these interactions . Chemical crosslinking coupled with mass spectrometry (XL-MS) offers spatial information about protein complexes, identifying specific residues involved in TIMM21 interactions and how these change during different stages of import. Proximity-based approaches like bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) enable real-time monitoring of TIMM21 interactions in living cells, particularly valuable for capturing transient associations during the dynamic import process. Split-GFP complementation assays, wherein fragments of GFP are fused to TIMM21 and potential partners, provide visual confirmation of interactions through fluorescence reconstitution. For mapping interaction domains, yeast two-hybrid screening or bacterial expression of truncated TIMM21 variants can systematically identify regions essential for specific protein-protein interactions . Collectively, these complementary approaches provide a comprehensive view of how bovine TIMM21 engages with other components of the mitochondrial import machinery under different physiological conditions.

What are the recommended protocols for studying the effect of presequence signals on bovine TIMM21-Tim50 interactions?

The study of presequence-induced changes in TIMM21-Tim50 interactions requires carefully designed protocols that recapitulate the natural sequence of events during mitochondrial protein import. A comprehensive approach begins with the preparation of synthetic presequence peptides derived from well-characterized bovine mitochondrial proteins, typically 20-30 amino acids in length and incorporating a fluorescent label or biotin tag for detection. These peptides should be validated for mitochondrial targeting activity in import assays before use in interaction studies. For in vitro binding assays, purified recombinant bovine TIMM21 and Tim50 (particularly the intermembrane space domain) should be produced with appropriate affinity tags and confirmed for proper folding using circular dichroism spectroscopy . Surface plasmon resonance provides an effective method for measuring the kinetics of TIMM21-Tim50 binding in real-time, enabling researchers to observe how the introduction of presequence peptides at various concentrations modifies this interaction . Microscale thermophoresis offers an alternative approach that requires smaller quantities of protein while providing similar kinetic data. For structural insights, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of TIMM21 and Tim50 that undergo conformational changes upon presequence binding, revealing the molecular mechanism of signal-induced dissociation. In an organellar context, researchers can employ submitochondrial vesicles containing the purified translocase components to study how presequence peptides affect TIMM21-Tim50 interactions in a more native membrane environment. Crosslinking studies using photo-activatable presequence peptides can capture transient intermediates formed during the signal recognition process, providing snapshots of the dynamic reorganization events . These approaches collectively enable detailed characterization of how presequence signals drive the dissociation of TIMM21 from Tim50, a pivotal event in the switch between different functional states of the presequence translocase.

How can researchers effectively analyze local ancestry patterns of TIMM21 in hybrid bovine populations?

Analysis of local ancestry patterns at the TIMM21 locus in hybrid bovine populations requires a sophisticated genomic approach that combines high-density genotyping, appropriate reference populations, and specialized statistical methods. The foundation of such analysis begins with high-quality genotyping data, ideally using platforms like the Illumina BovineHD 777K BeadChip that provide dense SNP coverage across the genome, including the TIMM21 locus and surrounding regions . Reference populations should include pure taurine breeds (e.g., Muturu and N'Dama) and pure zebu breeds (e.g., Gir and Nelore) that represent the ancestral populations contributing to the hybrid genomes . For local ancestry inference, algorithms like MOSAIC are particularly effective as they implement a two-layer Hidden Markov Model that determines chromosome segment ancestry without requiring predefined surrogate donor reference populations . Phased haplotypes generated using tools like SHAPEIT v2 and an appropriate recombination map improve the accuracy of local ancestry calls . To specifically assess whether TIMM21 shows ancestry patterns deviating from genome-wide expectations, researchers should implement an unweighted block bootstrap approach to generate distributions of local ancestry deviation, comparing the TIMM21 locus (including flanking regions extending 2.5 Mb upstream and downstream) against the genome-wide background . Statistical significance of ancestry deviations should be assessed using permutation tests that generate empirical null distributions while accounting for complex genomic structure. Visualization of ancestry patterns can be achieved through tools like Admixture painting or custom R scripts that display local ancestry estimates across chromosomal segments. This methodological approach enables researchers to determine whether selection has favored particular ancestral variants of TIMM21 in hybrid cattle populations, providing insights into the functional importance of mitonuclear compatibility in these systems .

What are the major technical challenges in producing functional recombinant bovine TIMM21?

Production of functional recombinant bovine TIMM21 presents several technical challenges that require strategic approaches to overcome. The primary difficulty stems from TIMM21's nature as a membrane-associated protein, which often leads to solubility issues, misfolding, and aggregation during heterologous expression. When expressed in bacterial systems like E. coli, bovine TIMM21 frequently forms inclusion bodies, necessitating complex refolding protocols that may not fully recapitulate the native structure. Researchers must optimize expression conditions through systematic testing of temperatures (typically lowering to 16-18°C), inducer concentrations, and host strains specially designed for membrane protein expression such as C41(DE3) or C43(DE3). Fusion tags can improve solubility, with MBP (maltose-binding protein) or SUMO tags often proving more effective than conventional His-tags for maintaining TIMM21 in solution. The hydrophobic nature of TIMM21's membrane-interacting regions creates additional complications during purification, requiring careful selection of detergents that maintain protein stability without disrupting functionally important conformations. Detergent screening should evaluate mild non-ionic options like DDM (n-dodecyl-β-D-maltoside) or digitonin that preserve native-like structures. Another significant challenge lies in verifying the functional integrity of the recombinant protein, as standard activity assays for translocase components require reconstitution of multiple interacting partners. Researchers must develop robust binding assays with purified Tim50 to confirm that recombinant TIMM21 maintains proper interaction capabilities . Post-translational modifications present in native bovine TIMM21 may be absent in bacterial expression systems, potentially necessitating eukaryotic expression platforms like insect cells or mammalian cells for fully functional protein. These technical challenges collectively explain why structural and functional studies of bovine TIMM21 have progressed more slowly than for soluble mitochondrial proteins.

How can conflicting data regarding TIMM21 function across different experimental systems be reconciled?

Reconciling conflicting data regarding TIMM21 function across experimental systems requires careful consideration of multiple factors that influence experimental outcomes. Species-specific differences represent a primary source of discrepancies, as studies in yeast, human, and bovine systems may reflect genuine evolutionary divergence in TIMM21 function rather than experimental artifacts. Researchers should perform direct comparative analyses using the same methodological approaches across species to distinguish true functional differences from technique-related variations. Expression level disparities frequently confound interpretation, as TIMM21 overexpression may disrupt stoichiometric balances within the import machinery, potentially generating phenotypes that do not reflect physiological function. Titration experiments with varying expression levels can help identify concentration-dependent effects and establish proper ranges for functional studies. Post-translational modification patterns differ substantially between recombinant systems and native contexts, potentially explaining functional discrepancies when using bacterially-expressed proteins lacking key modifications. Mass spectrometry analysis of native TIMM21 can identify critical modifications that should be preserved or mimicked in experimental systems. Interaction partner availability varies across experimental platforms, with yeast systems potentially lacking mammalian-specific auxiliary factors that modify TIMM21 function in bovine mitochondria. Complementation experiments introducing bovine interaction partners into simpler systems can help address this variable. Methodological differences in assessing protein import (in vitro reconstituted systems versus in organello or in vivo approaches) measure distinct aspects of TIMM21 function, with in vitro systems typically capturing direct biochemical interactions while cellular systems reflect the integrated physiological role including regulatory influences . A comprehensive reconciliation strategy should integrate findings across multiple experimental platforms while explicitly acknowledging the limitations of each system, leading to a nuanced understanding of TIMM21's evolutionarily conserved core functions and species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.