Recombinant Bovine Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Mitochondrial Import Inner Membrane Translocase Subunit TIM50 (TIMM50)

Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50) is a protein vital for the import of proteins into mitochondria . In humans, the TIMM50 gene encodes this protein . TIMM50 is a component of the Tim23 translocase complex located in the inner mitochondrial membrane (MIM) . This complex facilitates the movement of proteins with transit peptides across the inner mitochondrial membrane .

Gene Structure and Protein Characteristics

The TIMM50 gene resides on the q arm of chromosome 19 at position 13.2, spanning 13,373 base pairs . The gene codes for a 39.6 kDa protein, which comprises 353 amino acids . TIMM50 features a single transmembrane domain (TMD) near its N-terminal region . The N-terminal domain is smaller and faces the matrix, while the larger C-terminal domain is exposed to the intermembrane space (IMS) .

Function of TIMM50

TIM50 functions as a receptor subunit that recognizes the mitochondrial targeting signal, also known as the presequence, found on proteins destined for the mitochondrial inner membrane and matrix . The protein is essential for maintaining the membrane permeability barrier . TIM50 interacts with the TIM23 complex and influences the translocation pore . Knockdown of TIMM50 in human cells leads to cytochrome c release and apoptosis .

Role in Steroid Synthesis

TIMM50 plays a critical role in adrenal and gonadal steroid synthesis . It interacts with cytochrome P450 side-chain cleavage enzyme (CYP11A1 or SCC), which catalyzes the conversion of cholesterol to pregnenolone . TIM50 also interacts with 3-beta-hydroxysteroid dehydrogenase type 2 (3βHSD2), which helps convert pregnanolone to progesterone .

TIMM50 Interactions and Complex Formation

Following integration of the SCC C-terminus into the TIM23 complex, amino acids 141 to 146 interact with the intermembrane-exposed Tim50 protein, forming a large complex . The absence of Tim50 or its mutation reduces enzymatic activity .

Impact of TIMM50 Deficiency

TIMM50 deficiency can cause multiple mitochondrial bioenergetic dysfunctions . Mutations in TIMM50 can lead to epilepsy, severe intellectual disability, and 3-methylglutaconic aciduria . A study characterizing a TIMM50 disease-causing mutation in human fibroblasts revealed significant decreases in TIM23 core protein levels .

Effects on Mitochondrial Proteome

Research indicates that a significant proportion of mitochondrial proteins remain unaffected by TIMM50 deficiency . Mass spectrometry analysis of fibroblasts showed that the levels of approximately 65% of MIM proteins and 71% of matrix proteins were not affected in patients with TIMM50 mutations compared to healthy controls .

Table 1: Examples of Unaffected Mitochondrial Inner Membrane (MIM) Proteins

ProteinFunction
MICU2Calcium homeostasis
SLC25A3Calcium homeostasis
LETM1Calcium homeostasis
PPOXHeme synthesis
CPOXHeme synthesis
HADHACardiolipin synthesis

Table 2: Examples of Unaffected Matrix Proteins

ProteinFunction
NFS1Fe-S cluster biosynthesis
GLRX5Fe-S cluster biosynthesis
ISCUFe-S cluster biosynthesis
PRDX5Detoxification
SOD2Detoxification
ABHD10Detoxification
GSTK1Detoxification
DECR1Fatty acid oxidation
ECHS1Fatty acid oxidation
ETFAFatty acid oxidation
PYCR1Amino acid metabolism
ALDH18A1Amino acid metabolism
HIBCHAmino acid metabolism
ACO2TCA cycle
DLSTTCA cycle
IDH3BTCA cycle
OGDHTCA cycle

Role in Cancer

TIM50 expression is increased in breast cancer cells . TIM50 levels directly correlate with the growth and proliferation of various types of cancer cells as well as plant tissues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIMM50; TIM50; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-355
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TIMM50
Target Protein Sequence
GTKAQTQGPQQQRSSEGPSYAKKVALWLARLLGAGGTVSVIYIFGNNAVDENGAKIPDEF DNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLREPYYQPPYTLVLELTGVLLHPE WSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDA TRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAF LKTIALNGVEDVRTVLEHYALEEDPLEAFKQRQSRLEQEEQQRLAELSKSSKQNLFFSSL TSRLWPRSKQP
Uniprot No.

Target Background

Function
TIMM50 is a crucial component of the TIM23 complex, responsible for translocating proteins containing transit peptides across the mitochondrial inner membrane. While exhibiting in vitro phosphatase activity, its in vivo relevance remains unclear.
Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of TIMM50 in mitochondria?

TIMM50 (also known as Tim50) serves as the receptor component of the TIM23 complex in the mitochondrial inner membrane. Its primary function is to facilitate the import of preproteins from the cytosol into the mitochondria. In particular, TIMM50 is essential for the import of matrix and inner membrane proteins with cleavable presequences, which are substrates of the TIM23 complex . Studies indicate that TIMM50 facilitates the import of approximately 60% of the total mitochondrial proteome, highlighting its critical importance in maintaining mitochondrial function .

The protein functions by interacting with precursor proteins as soon as they reach the trans side of the TOM (Translocase of the Outer Membrane) complex. This interaction continues as long as segments of the precursor protein are present in the intermembrane space (IMS) . This positioning allows TIMM50 to serve as a crucial bridge between the outer and inner membrane translocation machineries.

What is the structural composition of TIMM50?

The crystal structure of the intermembrane space (IMS) domain of Tim50 has been determined and provides valuable insights into its function. The structure reveals that Tim50 contains a large groove that serves as a putative binding site for presequences of incoming proteins . This structural feature is critical for its receptor function.

Crystallographic data for the Tim50 IMS domain shows it crystallizes in the P6₁22 space group with cell dimensions a = 84.109 Å and c = 116.549 Å. The structure was refined to 1.83 Å resolution with an R factor of 19.3% and R free of 22.4% . The crystal structure includes residues 176-361 of Tim50, which form the functional IMS domain. The table below presents the detailed crystallographic data:

Tim50 IMS ParameterValue
Space groupP6₁22
Cell dimensions a, c (Å)84.109, 116.549
Wavelength (Å)1.000
Resolution (Å)1.83
R sym0.0613 (0.266)
I / sigmaI42.1 (5.2)
Completeness (%)98.8 (91.9)
Redundancy8.2 (7.1)
No. reflections20436
R factor / R free0.193/0.224
No. atoms (Non-water)1532
No. waters132
Bond lengths (Å)0.015
Bond angles (°)1.578

Recent research suggests that Tim50 has multiple domains that coordinate protein translocation across both mitochondrial membranes, indicating a complex structural organization that contributes to its functional versatility .

How does TIMM50 deficiency affect mitochondrial function?

What are the optimal methods for expressing and purifying recombinant bovine TIMM50?

For successful expression and purification of recombinant bovine TIMM50, a multi-step approach is recommended based on established protocols. The coding region should be amplified by PCR and cloned into an appropriate expression vector. For structural studies, researchers have successfully used bacterial expression systems, though eukaryotic expression systems may be preferable for functional studies requiring post-translational modifications.

The purification protocol typically involves:

  • Cell lysis under native conditions using buffer containing mild detergents

  • Initial purification using affinity chromatography (often with His-tagged constructs)

  • Further purification by ion exchange chromatography

  • Final polishing step using size exclusion chromatography

For structural analysis, as demonstrated in previous research, the purified protein can be subjected to crystallization trials. Successful crystallization has been achieved using hanging-drop vapor diffusion methods. The crystal structure can then be determined using molecular replacement approaches, as was done with Scp1 (PDB code: 2GHQ) serving as a search model . The structural model can be built using programs like WARP/ARP and COOT, with refinement performed using programs such as CNS and Refmac5 .

For functional studies, it is crucial to ensure that the recombinant protein maintains its native conformation, which can be verified using circular dichroism spectroscopy and limited proteolysis assays.

How can researchers assess TIMM50 interactions with preproteins in vitro?

To investigate the interactions between TIMM50 and preproteins, researchers can employ several biochemical and biophysical techniques that have been validated in previous studies.

Cross-linking experiments provide valuable insights into the dynamic interactions between Tim50 and incoming precursor proteins. This approach involves:

  • Preparing radiolabeled precursor proteins using in vitro transcription/translation systems

  • Incubating the precursor proteins with isolated mitochondria under conditions that promote or arrest import

  • Applying chemical cross-linkers such as DFDNB (1,5-difluoro-2,4-dinitrobenzene)

  • Analyzing cross-linked products by immunoprecipitation with antibodies against Tim50, followed by SDS-PAGE and autoradiography

This technique has successfully demonstrated that Tim50 interacts with precursor proteins as they emerge from the TOM complex and that this interaction is dynamic, decreasing as the precursor is imported into the mitochondria .

For more quantitative assessment of binding affinities, researchers can use techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) with purified TIMM50 and synthetic presequence peptides. These approaches allow determination of binding constants and can help identify critical residues involved in the interaction.

What experimental approaches can be used to study the impact of TIMM50 mutations on mitochondrial protein import?

Investigating the effects of TIMM50 mutations on protein import requires a comprehensive experimental framework combining in vitro and cellular approaches.

For in vitro assessment:

  • Generate recombinant TIMM50 variants with specific mutations using site-directed mutagenesis

  • Reconstitute protein import assays using isolated mitochondria and radiolabeled precursor proteins

  • Compare import efficiency between wild-type and mutant TIMM50 using techniques such as blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by autoradiography

  • Analyze the kinetics of import by performing time-course experiments

For cellular models:

  • Deplete endogenous TIMM50 using RNA interference (shRNA) approaches or CRISPR/Cas9 gene editing

  • Complement with wild-type or mutant TIMM50 constructs

  • Assess global mitochondrial protein import using proteomic approaches

  • Evaluate specific functional consequences using assays for mitochondrial membrane potential, respiratory capacity, and cellular bioenergetics

These complementary approaches can provide comprehensive insights into how specific mutations affect TIMM50 function. For example, researchers have successfully used such methods to demonstrate that protein traffic into mitochondria can be disrupted by amino acid substitutions in substrate preproteins .

How does TIMM50 dysfunction contribute to neurological pathologies in model systems?

TIMM50 dysfunction has been linked to severe neurological pathologies, which can be studied in various experimental models. All TIMM50 mutant patients studied thus far have displayed severe neurological pathologies, including epilepsy, developmental delay, and loss of movement abilities .

To investigate the neurophysiological consequences of TIMM50 deficiency, researchers have employed whole-cell patch clamp techniques to measure intrinsic neuronal excitability and spontaneous neurotransmitter release. Experimental approaches include:

  • Establishment of neuronal cell cultures with TIMM50 knockdown (KD)

  • Assessment of miniature excitatory post-synaptic currents (mEPSCs) in the presence of tetrodotoxin (TTX)

  • Measurement of action potential characteristics by gradually increasing stimulation current

  • Analysis of parameters such as rheobase, action potential half-width, rate of fall, latency, and maximum number of action potentials

Results from such studies have revealed that TIMM50 KD causes neurons to fire more action potentials without decreasing the firing threshold, likely due to a faster recovery time between successive action potentials . These findings provide valuable insights into how TIMM50 deficiency affects neuronal function and contributes to neurological disorders.

What methods are most effective for assessing TIMM50's role in mitochondrial bioenergetics?

To evaluate TIMM50's impact on mitochondrial bioenergetics, researchers can utilize a combination of biochemical and cellular approaches. One particularly effective method is the Seahorse XF analyzer, which allows real-time measurements of oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) in live cells.

The experimental protocol typically involves:

  • Plating cells (fibroblasts or neurons) in Seahorse XF 96-well plates at appropriate density

  • For neuronal cultures, cells can be transduced with TIMM50 knockdown constructs (e.g., Sh2) or control constructs (e.g., Scr)

  • Prior to the experiment, washing cells and replacing the medium with Seahorse XF DMEM (pH 7.4)

  • Measuring baseline OCR and ECAR

  • Sequential addition of mitochondrial inhibitors to assess different parameters of mitochondrial function (e.g., oligomycin to inhibit ATP synthase, FCCP to uncouple respiration, rotenone/antimycin A to inhibit the electron transport chain)

This approach allows researchers to determine how TIMM50 deficiency affects various aspects of mitochondrial function, including basal respiration, ATP production, maximal respiratory capacity, and spare respiratory capacity.

Additionally, proteomic analysis can be performed to identify changes in protein levels resulting from TIMM50 deficiency. This involves:

  • Sample preparation from control and TIMM50-deficient cells

  • Mass spectrometry analysis

  • Statistical analysis using software such as Perseus

  • Classification of mitochondrial proteins using databases like MitoCarta3.0

  • Gene ontology (GO) term analysis using tools like DAVID

These approaches provide comprehensive insights into how TIMM50 contributes to mitochondrial bioenergetics and how its dysfunction affects cellular energy metabolism.

How do the multiple domains of TIMM50 coordinate protein translocation across mitochondrial membranes?

Recent research indicates that Tim50 contains multiple domains that work together to coordinate protein translocation across both mitochondrial membranes . Understanding this coordination requires sophisticated structural and biochemical analyses.

To investigate domain-specific functions, researchers can:

  • Generate domain-specific deletion or point mutation constructs

  • Assess the impact of these mutations on Tim50's interaction with other components of the import machinery (Tim23, Tim17, Tim44)

  • Evaluate the effect on precursor protein recognition and translocation

  • Perform cross-linking studies with domain-specific probes to map interaction interfaces

What are the optimal conditions for assessing TIMM50's phosphatase activity in experimental settings?

TIMM50 belongs to the HAD-phosphatase family, suggesting it possesses phosphatase activity that may contribute to its cellular functions . To assess this activity experimentally, researchers should consider:

  • Expression and purification of full-length TIMM50 or its phosphatase domain under native conditions

  • Preparation of appropriate phosphorylated substrates (both artificial substrates like para-nitrophenylphosphate and potential physiological substrates)

  • Optimization of reaction conditions (pH, temperature, divalent cation requirements)

  • Quantification of phosphate release using colorimetric assays or radiolabeled substrates

Additionally, researchers can investigate how this phosphatase activity relates to TIMM50's role in protein import and other cellular functions through:

  • Generation of phosphatase-dead mutants by site-directed mutagenesis of catalytic residues

  • Assessment of these mutants' ability to complement TIMM50 deficiency in cellular models

  • Evaluation of potential phosphorylation targets within the mitochondrial import machinery

This multifaceted approach can provide valuable insights into the relationship between TIMM50's enzymatic activity and its various cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.