Recombinant Bovine Mitochondrial import receptor subunit TOM20 homolog (TOMM20)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine TOMM20

Recombinant Bovine Mitochondrial Import Receptor Subunit TOM20 Homolog (TOMM20) is a Bos taurus-derived protein engineered for research applications. Produced in yeast, this recombinant protein corresponds to amino acids (AA) 1–145 of the native TOMM20, fused with a polyhistidine (His) tag for purification . It serves as a critical component in studying mitochondrial protein import mechanisms and receptor-ligand interactions, particularly in ELISA-based assays .

Domain Architecture

  • N-terminal transmembrane anchor: AA 1–25, embedded in the mitochondrial outer membrane .

  • Cytosolic domain: AA 30–145, responsible for substrate recognition and interaction with presequences .

    • Membrane-binding region: AA 30–60 .

    • Targeting signal recognition: AA 50–90, binds α-helical presequences (e.g., matrix-targeting signals) .

Presequence Recognition

TOMM20 binds N-terminal mitochondrial targeting signals (MTS) via its cytosolic domain, preferring α-helical conformations (dissociation constant Kd ≈ 0.6 µM) .

Dual Receptor Mechanism

  1. Specificity: The N-terminal binding element (AA 50–90) ensures substrate selectivity .

  2. Efficiency: A C-terminal region (AA 90–145) tethers presequences to the TOM40 channel, accelerating translocation .

Regulation of Import Kinetics

  • Overexpression of TOMM20 increases import rates of matrix proteins (e.g., malate dehydrogenase) .

  • Antisense knockdown reduces import efficiency by 40–60%, highlighting its rate-limiting role .

Biochemical Properties

PropertyDetail
Expression HostYeast
Purity>90% (SDS-PAGE)
TagHis tag
Molecular Weight~20 kDa (predicted)
ApplicationsELISA, protein interaction studies
UniProt IDA6H7B1 (Bovine)

Data derived from .

Interaction Partners

  • Bcl2: TOMM20 mediates Bcl2 transfer from ER to mitochondria during apoptosis .

  • RNA-binding proteins (RBPs): Proximity labeling identifies SYNJBP2 and translation factors as TOMM20-associated partners, suggesting roles in mRNA localization .

Disease Relevance

  • Cancer: TOMM20 overexpression in colorectal cancer enhances proliferation, invasion, and mitochondrial ATP production .

  • Neurodegeneration: Defective TOMM20 disrupts mitochondrial protein import, linked to Parkinson’s disease .

Comparative Analysis of Recombinant TOMM20 Variants

FeatureBovine TOMM20 (AA 1–145) Human TOMM20 (AA 23–145)
HostYeastE. coli
TagHisGST/His
Purity>90%>95%
ApplicationsELISAELISA, WB

Future Directions

  • Therapeutic targeting: TOMM20 suppression reduces tumor growth in xenograft models, suggesting oncogenic potential .

  • Mechanistic studies: Elucidating TOMM20’s role in mRNA translation at the mitochondrial surface .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Kindly consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TOMM20; Mitochondrial import receptor subunit TOM20 homolog; Mitochondrial 20 kDa outer membrane protein; Outer mitochondrial membrane receptor Tom20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TOMM20
Target Protein Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Uniprot No.

Target Background

Function
TOM20 is a central component of the receptor complex responsible for recognizing and translocating cytosolically synthesized mitochondrial preproteins. In collaboration with TOM22, it acts as the transit peptide receptor on the surface of the mitochondrial outer membrane, facilitating the movement of preproteins into the TOM40 translocation pore. It is essential for the translocation of cytochrome P450 monooxygenases across the mitochondrial outer membrane.
Database Links
Protein Families
Tom20 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the functional role of TOMM20 in mitochondrial protein import?

TOMM20 functions as a primary receptor subunit of the Translocase of the Outer Membrane (TOM) complex, which serves as the main entry gate for nuclear-encoded mitochondrial proteins. TOMM20 specifically recognizes and binds precursor proteins destined for mitochondria, particularly those containing N-terminal mitochondrial targeting sequences. After binding these precursor proteins, TOMM20 transfers them to other components of the TOM complex, including Tom22 and the general import pore formed primarily by Tom40, facilitating their translocation across the outer mitochondrial membrane .

Research has demonstrated that TOMM20 is not permanently associated with the core TOM complex but rather interacts dynamically, showing higher lateral mobility in the membrane compared to core components like Tom7. This dynamic association appears to be functionally significant, as TOMM20 mobility decreases when substrate proteins are available, suggesting that TOMM20 associates with the TOM core complex during active protein import .

How is TOMM20 structurally associated with the TOM complex?

TOMM20 exhibits a dynamic association pattern with the TOM core complex rather than serving as a permanent fixture. Blue Native PAGE (BN-PAGE) analysis has revealed that TOMM20 is present in the intact TOM complex (~600 kDa) but absent from smaller subcomplexes. Additionally, TOMM20 has been identified in a separate ~200 kDa complex that lacks Tom40 and Tom7, suggesting interaction with other proteins such as voltage-dependent anion channel (VDAC) .

Recent cryo-EM structures of TOM complex monomers and dimers notably lack TOMM20, which is only found in the trimeric TOM complex (TOM3). This structural evidence supports the dynamic assembly/disassembly model. When comparing TOMM20 with other receptor components, it has been observed that TOMM20 is more stably associated with the core complex than TOMM70, which typically migrates as a homodimer on Blue Native PAGE, indicating a looser association .

What experimental approaches are most effective for studying TOMM20 dynamics in membrane environments?

Single Particle Tracking (SPT) microscopy represents a powerful approach for investigating TOMM20 dynamics in intact cellular environments. This methodology involves fluorescently labeling TOMM20 (e.g., with HaloTag ligands like SiR HTL) and tracking individual molecules over time to determine diffusion coefficients and mobility patterns .

The experimental workflow typically includes:

  • Expression of tagged TOMM20 constructs in appropriate cell lines

  • Labeling with membrane-permeable fluorescent ligands

  • Live-cell imaging using high-resolution microscopy

  • Analysis of trajectory data to extract diffusion coefficients and step lengths

  • Computational fitting of probability density functions to identify subpopulations with distinct mobility characteristics

Using this approach, researchers have identified at least three distinct subpopulations of TOMM20 with different diffusion coefficients, corresponding to different interaction states: free TOMM20, TOMM20 associated with smaller complexes, and TOMM20 bound to the active TOM complex .

How does the interactome of TOMM20 differ from other TOM receptors like TOMM70?

Proximity labeling approaches using APEX2 enzyme fusions have revealed distinct interaction profiles for TOMM20 and TOMM70, despite both being receptor components of the TOM complex. Comparative analysis demonstrates that TOMM20 interacts with a different set of proteins than TOMM70, with only minimal overlap in their respective interactomes .

Key differences include:

  • TOMM20 associates with more mitochondrial outer membrane (MOM) proteins compared to TOMM70 (14 vs. 6 MOM proteins in one study)

  • TOMM20 shows significant interaction with translation factors and ribosomal proteins, supporting its role in co-translational import

  • TOMM20 specifically associates with RNA-binding proteins like SYNJ2BP, suggesting involvement in localized translation at the mitochondrial surface

  • TOMM70 interacts with proteins from various submitochondrial compartments including the intermembrane space (IMS), mitochondrial inner membrane (MIM), and matrix

These differential interaction patterns align with the specialized functions of each receptor: TOMM20 primarily recognizes presequence-containing proteins and participates in co-translational import, while TOMM70 predominantly handles hydrophobic proteins with internal targeting signals .

What is the relationship between TOMM20 and alpha-synuclein in Parkinson's disease pathophysiology?

Recent research has uncovered a critical interaction between TOMM20 and alpha-synuclein that contributes to dopaminergic neurodegeneration in Parkinson's disease. Under pathological conditions, toxic buildup of alpha-synuclein directly interacts with TOMM20, blocking the import of essential proteins into mitochondria. This blockade impairs mitochondrial function and ultimately contributes to the death of dopamine-producing neurons in the substantia nigra .

Experimental evidence from rat models demonstrates that overexpression of human TOMM20 using adeno-associated virus-2 (AAV2) vectors can rescue dopaminergic neurons from alpha-synuclein-induced damage. This therapeutic effect occurs by restoring mitochondrial protein import that is otherwise inhibited by alpha-synuclein accumulation .

The TOMM20-alpha-synuclein interaction represents a potential therapeutic target for disease intervention. Strategies targeting this interaction could include:

  • Gene therapy approaches to increase TOMM20 expression

  • Small molecule inhibitors that prevent alpha-synuclein binding to TOMM20

  • Peptide-based therapeutics that compete with alpha-synuclein for TOMM20 binding

  • Compounds that enhance mitochondrial protein import downstream of TOMM20

How do diffusion characteristics of TOMM20 correlate with its functional states?

Single particle tracking studies have revealed multiple subpopulations of TOMM20 with distinct diffusion properties, providing insights into its functional states. Analysis of diffusion coefficient distributions typically identifies three major fractions of TOMM20 with different mobility characteristics :

TOMM20 FractionDiffusion CoefficientProposed Functional State
High mobility~0.3-1.0 μm²/sFree TOMM20
Intermediate mobility~0.03-0.3 μm²/sTOMM20 in smaller complexes (e.g., with VDAC)
Low mobility<0.03 μm²/sTOMM20 associated with TOM complex during active import

Several experimental approaches have confirmed the relationship between TOMM20 mobility and functional state:

  • Post-translational protein trans-splicing using the Gp41-1 integrin system to ligate TOMM20 with TOM7 resulted in significantly decreased TOMM20 mobility, confirming that association with the TOM complex reduces lateral diffusion

  • Exposure to high substrate loading conditions led to reduced TOMM20 mobility, supporting the model that TOMM20 associates more stably with the TOM complex during active protein import

  • Trajectory maps reveal homogeneous distribution of high and low mobility TOMM20 molecules across individual mitochondria, indicating that different functional states are not spatially segregated

What role does TOMM20 play in co-translational import of mitochondrial proteins?

Emerging evidence supports TOMM20's involvement in co-translational import of mitochondrial proteins, challenging the traditional view that mitochondrial protein import occurs exclusively post-translationally. Proximity labeling studies have revealed that TOMM20 associates with translation factors, ribosomal proteins, and RNA-binding proteins, suggesting a role in localized translation at the mitochondrial outer membrane .

Multiple lines of evidence support TOMM20's involvement in co-translational import:

  • Identification of ribosomes at the mitochondrial outer membrane through electron microscopy and biochemical approaches

  • Proximity-labeling based RNA sequencing identifying hundreds of mRNAs at the mitochondrial outer membrane, with most encoding mitochondrial proteins (mitoRNAs)

  • Demonstration that localization of these mRNAs depends on active translation, likely via the mitochondrial targeting signal in the nascent chain complex

  • Studies showing that yeast TOM20 contributes to the co-translational import of mitochondrial proteins

  • TOMM20 exhibits stronger association with translation machinery components compared to TOMM70, suggesting specialized roles in co-translational import

This co-translational import pathway may increase efficiency by reducing the cytosolic exposure of hydrophobic mitochondrial proteins and preventing their aggregation before import.

What techniques are recommended for producing and purifying recombinant bovine TOMM20?

Production of functional recombinant bovine TOMM20 requires careful consideration of its membrane protein nature. Based on established protocols for human and yeast homologs, the following methodological approach is recommended:

  • Expression construct design:

    • Clone bovine TOMM20 cDNA into a suitable expression vector (e.g., pET or pGEX systems)

    • Consider using only the cytosolic domain (amino acids 1-102) for easier expression and purification

    • Include an affinity tag (His6 or GST) with a TEV protease cleavage site

    • Optimize codon usage for the expression host

  • Expression system selection:

    • For full-length TOMM20: Insect cell expression systems (Sf9 or High Five)

    • For cytosolic domain: E. coli BL21(DE3) or derivatives

    • Cell-free expression systems for rapid screening

  • Purification protocol:

    • For full-length TOMM20:

      • Solubilize membranes with mild detergents (DDM, LDAO, or Triton X-100)

      • Purify using affinity chromatography followed by size exclusion

      • Consider reconstitution into nanodiscs for functional studies

    • For cytosolic domain:

      • Standard affinity purification followed by ion exchange and size exclusion

      • Maintain reducing conditions throughout purification

  • Functional validation:

    • Circular dichroism to confirm proper folding

    • Surface plasmon resonance to assess binding to presequence peptides

    • Reconstitution with other TOM components to assess complex formation

How can proximity labeling approaches be implemented to study TOMM20 interactions?

Proximity labeling represents a powerful approach for identifying transient and stable interaction partners of TOMM20 in intact cellular environments. The APEX2 (engineered ascorbate peroxidase) system has proven particularly effective for studying mitochondrial membrane proteins like TOMM20 .

Implementation protocol:

  • Construction of TOMM20-APEX2 fusion:

    • Fuse APEX2 to TOMM20, preserving proper membrane topology

    • Include flexible linker sequence between TOMM20 and APEX2

    • Verify localization using immunofluorescence or subcellular fractionation

  • Cell culture and expression:

    • Establish stable cell lines with inducible expression

    • Use appropriate controls (APEX2 alone, matrix-targeted APEX2, etc.)

    • Optimize expression to avoid overexpression artifacts

  • Proximity labeling procedure:

    • Incubate cells with biotin-phenol substrate (500 μM, 30 min)

    • Trigger labeling with brief H₂O₂ treatment (1 mM, 1 min)

    • Immediately quench with antioxidants

    • Lyse cells in denaturing conditions

  • Enrichment and analysis:

    • Capture biotinylated proteins using streptavidin beads

    • Analyze by mass spectrometry (LC-MS/MS)

    • Apply stringent statistical analysis (p-value ≤ 0.01)

    • Compare against appropriate controls (uninduced cells, NES-APEX2)

  • Validation of key interactions:

    • Immunoprecipitation or pull-down assays

    • Fluorescence microscopy (colocalization)

    • Functional assays to assess biological relevance

This approach has successfully identified distinct interactomes for TOMM20 and TOMM70, revealing specialized roles in protein import and co-translational processes .

What approaches can be used to investigate TOMM20's role in neurodegenerative disease models?

Investigating TOMM20's role in neurodegenerative diseases, particularly Parkinson's disease, requires a multi-faceted approach combining molecular, cellular, and in vivo methodologies:

  • Viral vector-based modulation in animal models:

    • Use adeno-associated virus (AAV) vectors to deliver TOMM20

    • Target stereotactic injections to the substantia nigra

    • Assess neuroprotective effects in toxin-induced or genetic models

    • Evaluate behavioral outcomes using standardized tests

  • Protein-protein interaction analysis:

    • Investigate TOMM20-alpha-synuclein interactions using:

      • Co-immunoprecipitation from brain tissue or cell models

      • Proximity ligation assays in fixed cells/tissues

      • FRET or BRET assays in live cells

      • In vitro binding assays with purified proteins

  • Mitochondrial function assessment:

    • Measure protein import efficiency using fluorescent reporters

    • Assess mitochondrial membrane potential with potential-sensitive dyes

    • Evaluate respiratory chain function with Seahorse XF analyzers

    • Analyze mitochondrial morphology and dynamics by live imaging

  • Therapeutic intervention strategies:

    • Screen for compounds that enhance TOMM20 function or expression

    • Design peptides that block alpha-synuclein-TOMM20 interaction

    • Develop gene therapy approaches to increase TOMM20 levels

    • Test combination approaches targeting multiple mitochondrial pathways

  • Patient-derived models:

    • Analyze TOMM20 function in iPSC-derived neurons from patients

    • Develop organoid models to study TOMM20 in 3D neural tissues

    • Correlate TOMM20 dysfunction with disease progression markers

This comprehensive methodological framework allows for detailed mechanistic studies while maintaining translational relevance for therapeutic development .

What are the most promising applications of recombinant bovine TOMM20 in research and therapeutics?

Recombinant bovine TOMM20 offers several promising research and therapeutic applications:

  • Structural biology platforms:

    • Crystallization trials for high-resolution structural determination

    • Cryo-EM analysis of TOMM20 in complex with substrate proteins

    • NMR studies of dynamic interactions with presequence peptides

  • Drug discovery:

    • High-throughput screening platforms to identify compounds that modulate TOMM20-substrate interactions

    • Structure-based design of peptides that enhance mitochondrial protein import

    • Development of biologics that prevent pathological interactions with alpha-synuclein

  • Diagnostic applications:

    • Development of assays to measure mitochondrial import efficiency in patient samples

    • Biomarker identification for mitochondrial dysfunction in neurodegenerative diseases

    • Imaging probes for visualizing mitochondrial import defects in vivo

  • Therapeutic protein development:

    • Fusion proteins combining TOMM20 with therapeutic enzymes for enhanced mitochondrial delivery

    • Cell-penetrating TOMM20 variants for mitochondrial targeting in gene therapy

    • Nanoparticle conjugation for targeted delivery to affected tissues

These applications leverage the fundamental role of TOMM20 in mitochondrial protein import while addressing unmet needs in mitochondrial medicine and neurodegenerative disease research .

How can single particle tracking methodologies be optimized for studying TOMM20 dynamics?

Optimizing single particle tracking (SPT) for TOMM20 dynamics requires addressing several technical challenges:

  • Labeling strategies:

    • HaloTag fusion proteins with membrane-permeable fluorescent ligands offer superior specificity

    • Optimal labeling density (1-5 molecules per μm²) prevents trajectory misassignment

    • Photostable fluorophores (e.g., SiR, JF646) enable longer tracking periods

    • Consider photoactivatable or photoswitchable fluorophores for higher spatial density

  • Acquisition parameters:

    • Frame rates: 20-100 fps depending on expected diffusion coefficients

    • Exposure time: 5-20 ms to minimize motion blur

    • Total acquisition duration: 30-60 seconds to capture sufficient trajectories

    • Microscopy platform: TIRF or spinning disk confocal for optimal signal-to-noise ratio

  • Trajectory analysis:

    • Implement robust tracking algorithms (e.g., u-track from Danuser lab)

    • Apply appropriate motion models (Brownian, confined, directed)

    • Generate probability density function (PDF) histograms of diffusion coefficients

    • Fit multiple Gaussian components to identify subpopulations

    • Analyze step length distributions for additional confirmation

  • Validation approaches:

    • Compare with other membrane proteins of known mobility

    • Use genetic fusions (e.g., TOMM20-TOM7) as mobility controls

    • Apply substrate loading to confirm functional correlations

    • Combine with FRAP or FCS for complementary diffusion measurements

  • Advanced analysis:

    • Trajectory segmentation to identify transition events between diffusion states

    • Hidden Markov Models to determine state transition probabilities

    • Correlation with localized protein import events using dual-color imaging

These optimizations would significantly enhance the spatiotemporal resolution of TOMM20 dynamics studies and provide deeper insights into functional mechanisms .

What are the key knowledge gaps in our understanding of TOMM20 function?

Despite significant advances in understanding TOMM20 biology, several important knowledge gaps remain:

  • The precise structural basis for the dynamic association between TOMM20 and the core TOM complex remains incompletely characterized, with limited high-resolution structural data available for the intact complex containing TOMM20 .

  • The regulatory mechanisms controlling TOMM20 association/dissociation with the TOM complex under different cellular conditions (stress, metabolic state, cell cycle) require further investigation .

  • The extent and significance of TOMM20's interaction with non-TOM proteins such as VDAC needs deeper exploration, particularly regarding potential roles in mitochondrial-cytosolic communication .

  • The contribution of TOMM20 to co-translational import pathways versus post-translational import remains incompletely quantified across different substrate classes and cellular conditions .

  • Species-specific differences in TOMM20 function between bovine and other mammalian systems require systematic comparative analysis to ensure translatability of findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.