Recombinant Bovine Mitochondrial import receptor subunit TOM22 homolog (TOMM22)

Shipped with Ice Packs
In Stock

Description

Overview

The Recombinant Bovine Mitochondrial Import Receptor Subunit TOM22 Homolog (TOMM22) is a genetically engineered protein crucial for mitochondrial protein import. As part of the Translocase of Outer Mitochondrial Membrane (TOM) complex, TOMM22 facilitates the recognition and translocation of nuclear-encoded mitochondrial precursor proteins into mitochondria. This recombinant variant is produced in heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) for research applications .

Domain Architecture

TOMM22 contains three functional domains:

  • Cytosolic domain: Binds mitochondrial presequences via a three-helix bundle structure .

  • Transmembrane domain (TMD): Anchors TOMM22 in the outer mitochondrial membrane and stabilizes interactions with Tom40 .

  • Intermembrane space (IMS) domain: Mediates precursor protein transfer to the TIM23 complex .

Expression Systems

Recombinant bovine TOMM22 is produced in multiple host systems:

  • Hosts: E. coli, yeast (Saccharomyces cerevisiae), baculovirus, or mammalian cells .

  • Purity: ≥85% as verified by SDS-PAGE .

Applications

  • Western blotting: Detects TOMM22 in mitochondrial extracts .

  • Functional studies: Analyzes presequence binding and protein import mechanisms .

Role in Mitochondrial Protein Import

  • TOMM22’s cytosolic domain binds presequences of precursor proteins (e.g., F0-ATPase subunit 9) with high affinity .

  • Its transmembrane domain interacts with Tom40 to stabilize the TOM complex structure .

Disease Relevance

  • Overexpression in pancreatic cancer correlates with poor prognosis and enhanced mitochondrial respiration .

  • Phosphorylation at S15 and T43 by CSNK2 regulates mitophagy in mammalian skeletal muscle .

Functional Assays

Assay TypeKey InsightReference
Pull-down assaysConfirmed TOMM22 binds presequence-containing proteins (e.g., Su9-DHFR-EGFP)
Mitochondrial importNo impairment observed in Csnk2b knockout mice, unlike yeast homologs
Cell growth assaysSilencing TOMM22 reduces pancreatic cancer cell proliferation and ATP levels

Comparative Analysis Across Species

  • Bovine vs. Yeast TOMM22: The IMS domain of bovine TOMM22 cannot be functionally replaced by yeast or plant homologs, indicating species-specific adaptations .

  • Phosphorylation Sites: Murine TOMM22 is phosphorylated at S15/T43 (vs. S44/S46 in yeast), altering mitophagy regulation .

Antibody Tools

  • Clone 4G4: Mouse monoclonal antibody (IgG2a) for FLISA, IF, IHC, and WB .

  • Polyclonal antibodies: Rabbit-derived, affinity-purified for human and mouse samples .

Future Directions

  • Therapeutic targeting: TOMM22 overexpression in cancers suggests potential for biomarker development .

  • Structural studies: High-resolution cryo-EM to map presequence-binding interfaces .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TOMM22; Mitochondrial import receptor subunit TOM22 homolog; Translocase of outer membrane 22 kDa subunit homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TOMM22
Target Protein Sequence
MAAAAAGPGAPLSADELLPKGDAEKPEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Uniprot No.

Target Background

Function
TOM22 is a central receptor component of the translocase of the outer membrane of mitochondria (TOM complex). It plays a crucial role in recognizing and translocating cytosolically synthesized mitochondrial preproteins. In conjunction with the peripheral receptor TOM20, it functions as the transit peptide receptor, facilitating the movement of preproteins into the translocation pore. TOM22 is essential for the translocation of cytochrome P450 monooxygenases across the mitochondrial outer membrane.
Gene References Into Functions
  1. Data demonstrate that LktA interacts with the Tom22 and Tom40 components of the translocase of the outer mitochondrial membrane (TOM), suggesting that import of this toxin into mitochondria involves a classical import pathway for endogenous proteins. PMID: 20109159
Database Links
Protein Families
Tom22 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the structure of bovine TOMM22 and how does it compare to homologs in other species?

Bovine TOMM22, like its homologs in other mammalian species, is a transmembrane protein localized to the mitochondrial outer membrane. Structural analyses reveal that the protein contains at least one transmembrane domain in a position similar to other Tom22 proteins. While sequence conservation among Tom22 homologs is generally poor, the transmembrane domain contains the most conserved residues across species. Notably, like other mammalian TOMM22 proteins, bovine TOMM22 is expected to have a longer N-terminal cytosolic domain compared to the truncated versions found in plants and apicomplexan parasites like Plasmodium falciparum .

Cross-species alignments indicate that only three residues are absolutely conserved across TOMM22/Tom22 proteins from yeast, humans, plants, and apicomplexans, with these conserved residues all located within the transmembrane domain . This suggests these residues may be critical for the protein's core function within the mitochondrial membrane.

What is the primary function of TOMM22 in mitochondrial protein import?

TOMM22 functions as a non-canonical receptor within the translocase of the outer mitochondrial membrane (TOM) complex. While traditional TOM receptors Tom20 and Tom70 recognize canonical mitochondrial targeting signals, TOMM22 has been demonstrated to recognize specific substrates independently of these receptors.

Most notably, TOMM22 has been shown to recognize and bind specific proteins like amyloid β (Aβ) peptides, which lack canonical mitochondrial targeting signals . The current model suggests that after initial substrate recognition by TOMM22, the substrate is transferred to another translocase subunit, TOMM40, and subsequently transported through the TOM channel into the mitochondria . This function is critical for both normal mitochondrial protein import and for understanding pathological protein accumulation in mitochondrial dysfunction.

How does TOMM22 integrate with the complete TOM complex machinery?

TOMM22 serves as an essential component of the TOM core complex, which consists of TOMM22, TOMM40, and three smaller TOM proteins. After initial substrate recognition by canonical receptors (TOMM20/TOMM70), TOMM22 typically mediates the intermediate step between substrate-receptor binding and substrate translocation through the TOMM40 central pore .

Experiments with yeast mitochondria demonstrate that TOMM22 depletion significantly disrupts the assembly and function of the TOM complex, suggesting a structural role beyond just substrate recognition. When TOMM22 is depleted or its function disrupted through techniques like destabilization domain tagging, the import of mitochondrial proteins is severely compromised, highlighting its essential role in maintaining mitochondrial protein homeostasis .

What expression systems are most effective for producing recombinant bovine TOMM22?

For recombinant expression of bovine TOMM22, bacterial expression systems using E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21) are commonly employed for the cytosolic domain. Based on experimental approaches with yeast Tom22, expressing the cytosolic domain of TOMM22 (cytoTOMM22) with a histidine tag allows for efficient purification while maintaining protein functionality for interaction studies .

For expression of full-length bovine TOMM22 including the transmembrane domain, eukaryotic expression systems such as insect cells (Sf9 or High Five) or mammalian cells (HEK293 or CHO) are preferable to ensure proper membrane integration and post-translational modifications. Codon optimization for the expression host significantly improves yield and quality of the recombinant protein.

Purification strategies typically involve:

  • Affinity chromatography using His-tag or GST-tag systems

  • Size exclusion chromatography to ensure protein homogeneity

  • Detergent screening to maintain native conformation of the transmembrane domain

What are the most reliable approaches for studying TOMM22-substrate interactions?

Several complementary approaches have proven effective for characterizing TOMM22-substrate interactions:

  • Analytical gel filtration chromatography: This technique can detect complex formation between purified cytoTOMM22 and potential substrate proteins. A shift in the elution peak of the mixture compared to individual proteins indicates complex formation. This approach was successfully used to demonstrate binding between cytoTom22 and Aβ peptides in vitro .

  • Mitochondrial import assays: Using isolated functional mitochondria, researchers can assess the accumulation of substrate proteins on the mitochondrial surface. By manipulating TOMM22 function (through antibody shielding, TEV protease cleavage, or competitive binding with soluble cytoTOMM22), the specific role of TOMM22 in substrate recognition can be determined .

  • Competition experiments: Adding purified cytoTOMM22 to a mixture of isolated mitochondria and substrate protein can reveal whether the soluble receptor competes with mitochondrial TOMM22 for substrate binding. This approach confirmed that cytoTom22, but not cytoTom20 or cytoTom70, competes with mitochondrial Tom22 for Aβ binding .

  • Electron microscopy with nanogold labeling: For visualizing protein interactions, substrates with a His-tag can be detected on the mitochondrial surface using Ni-NTA-conjugated nanogold particles and electron microscopy .

How can researchers identify the specific binding regions between TOMM22 and its substrates?

To map binding domains between TOMM22 and its substrates, several methodological approaches have proven effective:

  • Truncation mapping: Create truncated versions of both TOMM22 and the substrate protein to identify minimal binding regions. For example, dividing Aβ peptide into three segments (1-11, 12-24, and 25-42) and testing their mitochondrial accumulation revealed that residues 25-42 are responsible for interaction with Tom22 .

  • Site-directed mutagenesis: Introducing point mutations in conserved residues can identify specific amino acids critical for the interaction.

  • Peptide competition assays: Synthetic peptides corresponding to different regions of TOMM22 or its substrate can be used to compete with the full-length proteins, helping to narrow down the interaction interface.

  • Cross-linking coupled with mass spectrometry: This technique can identify residues in close proximity during protein-protein interactions, providing spatial constraints for modeling the interaction interface.

For bovine TOMM22, applying these techniques while considering the higher sequence conservation in the transmembrane domain would be particularly informative, as this region contains the most conserved residues across species .

What is the role of TOMM22 in amyloid β peptide accumulation in mitochondria and its relevance to neurodegenerative diseases?

TOMM22 plays a crucial role in the pathological accumulation of amyloid β (Aβ) peptides in mitochondria, a process implicated in Alzheimer's disease. Direct experimental evidence has shown that Aβ is specifically recognized by TOMM22 rather than the canonical import receptors TOMM20 and TOMM70 .

The mechanism of this interaction involves specific recognition of the Aβ(25-42) region by TOMM22. After initial recognition, Aβ is transferred to TOMM40 and transported through the TOM channel into mitochondria. This process represents a non-canonical pathway for mitochondrial protein import that contributes to mitochondrial dysfunction in Alzheimer's disease .

This TOMM22-mediated Aβ accumulation is extremely toxic because Aβ disrupts the normal functions of many mitochondrial proteins, resulting in significant mitochondrial dysfunction. Understanding this mechanism provides potential pharmaceutical targets for addressing mitochondrial dysfunction in Alzheimer's disease .

How can bovine TOMM22 be used as a model for studying human neurodegenerative diseases?

Bovine TOMM22 shares high sequence similarity with human TOMM22, making it a valuable model for studying mechanisms of protein import relevant to human diseases. Recombinant bovine TOMM22 can be used to:

  • Screen for inhibitors of TOMM22-Aβ interaction that might have therapeutic potential in preventing mitochondrial Aβ accumulation.

  • Develop structural models of the TOMM22-Aβ interaction interface that could inform structure-based drug design.

  • Establish in vitro assays for testing how disease-associated mutations affect protein import efficiency and specificity.

  • Create cellular models expressing bovine TOMM22 to study species-specific differences in mitochondrial protein import that might explain differential susceptibility to neurodegenerative diseases.

When using bovine TOMM22 as a model, researchers should consider that while the core functions are likely conserved, species-specific differences may affect the details of protein-protein interactions and regulatory mechanisms.

What genetic manipulation approaches can be used to study TOMM22 function in cellular models?

Several genetic approaches have proven effective for studying TOMM22 function:

What techniques can detect conformational changes in TOMM22 during substrate binding and translocation?

Understanding the dynamic changes in TOMM22 conformation during substrate binding and translocation requires specialized biophysical techniques:

  • FRET (Förster Resonance Energy Transfer): By labeling different domains of TOMM22 with fluorescent donor-acceptor pairs, researchers can monitor distance changes during substrate interaction in real-time.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique reveals regions of TOMM22 that undergo conformational changes upon substrate binding by measuring the rate of hydrogen-deuterium exchange.

  • Site-specific spin labeling coupled with EPR spectroscopy: This approach can measure distances between specific sites in TOMM22 during different stages of substrate binding and translocation.

  • Conformational antibodies: Antibodies that recognize specific conformational states of TOMM22 can be used to track conformational changes. This approach was used with Tom22, where monoclonal antibodies binding to folded Tom22 (and their Fab fragments) were employed to study its role in substrate recognition .

How can researchers distinguish between canonical and non-canonical substrate recognition by TOMM22?

Distinguishing canonical from non-canonical substrate recognition by TOMM22 requires carefully designed experiments:

  • Comparative binding assays: Testing the binding of both canonical mitochondrial preproteins and non-canonical substrates (like Aβ) with purified TOMM22 can reveal differences in binding affinities and mechanisms. For example, analytical gel filtration experiments demonstrated that cytoTom22 binds to Aβ but not to the canonical mitochondrial preprotein preADHIII .

  • Competition experiments: Using isolated mitochondria, researchers can test whether different purified Tom receptors (cytoTom20, cytoTom22, cytoTom70) in solution compete with mitochondrial accumulation of different substrates. Such experiments confirmed that only cytoTom22 competes with mitochondrial accumulation of Aβ .

  • Receptor-specific inhibition: Selectively inhibiting different TOM receptors (using antibodies, competitive peptides, or genetic approaches) can reveal their relative contributions to importing different substrates. When Tom22's cytosolic domain was removed using TEV protease, mitochondrial accumulation of Aβ was reduced to approximately 35% compared to control mitochondria, while accumulation of canonical substrates remained unaffected .

  • Structural studies: Determining the co-crystal structures of TOMM22 with different substrates can reveal distinct binding modes and interaction interfaces for canonical versus non-canonical substrates.

How might single-molecule techniques advance our understanding of TOMM22 function?

Single-molecule techniques offer unprecedented insights into the dynamics and heterogeneity of protein import processes that are obscured in bulk measurements:

  • Single-molecule FRET: This technique can track the conformational changes of individual TOMM22 molecules during substrate binding and transfer to TOMM40, revealing potential intermediate states.

  • Optical tweezers: By applying controlled forces to substrate proteins, researchers can measure the energetics and kinetics of TOMM22-mediated protein translocation at the single-molecule level.

  • Single-molecule fluorescence microscopy: Tracking fluorescently labeled substrates interacting with TOMM22 in real-time can reveal the kinetics of recognition, binding, and transfer steps.

  • Nanopore recordings: Reconstituting TOMM22 and the TOM complex in lipid bilayers allows for electrical recording of individual protein translocation events, providing insights into the biophysics of the process.

These approaches could help resolve current questions about the sequence of events in TOMM22-mediated protein import and the factors that determine substrate specificity.

What are the most promising approaches for developing therapeutics targeting TOMM22-substrate interactions?

Based on the critical role of TOMM22 in pathological processes like mitochondrial Aβ accumulation, several therapeutic approaches show promise:

  • Small molecule inhibitors: Developing compounds that specifically disrupt the interaction between TOMM22 and Aβ(25-42) could prevent mitochondrial Aβ accumulation while preserving normal protein import.

  • Peptide-based inhibitors: Designing peptides that mimic the Aβ(25-42) region could competitively inhibit the binding of full-length Aβ to TOMM22.

  • Antibody-based approaches: Developing antibodies or antibody fragments that selectively block the Aβ binding site on TOMM22 without disrupting essential import functions.

  • Allosteric modulators: Identifying compounds that bind to allosteric sites on TOMM22 to induce conformational changes that reduce Aβ binding affinity while maintaining canonical import functions.

The detailed understanding of the TOMM22-Aβ interaction interface, particularly the finding that Aβ(25-42) is responsible for the specific interaction with TOMM22 , provides a strong foundation for these therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.