Recombinant Bovine Mitochondrial inner membrane protease subunit 2 (IMMP2L)

Shipped with Ice Packs
In Stock

Description

Introduction

Inner mitochondrial membrane peptidase subunit 2 like (IMMP2L) is a protein that functions as a subunit of the mitochondrial inner membrane peptidase. This heterodimeric complex resides exclusively in the mitochondrial inner membrane, where it cleaves intermembrane space-sorting signals from precursor or intermediate polypeptides after they reach the inner membrane or the intermembrane space .

Function and Mechanism

IMMP2L is crucial for mitochondrial protein processing. It is involved in cleaving the mitochondrial targeting presequences of nuclear-encoded proteins imported into mitochondria . Specifically, IMMP2Lmutation impairs the signal peptide sequence processing of cytochrome c1 and mitochondrial glycerol phosphate dehydrogenase 2 (Gpd2) . Cyc1 forms part of Complex III of the mitochondrial respiratory chain, and the Gpd2 enzyme forms an integral component of the glycerol phosphate shuttle (GPS) .

Impact on Mitochondrial Function

IMMP2L plays a key role in enhancing mitochondrial function, particularly its interaction with GPD2 dehydrogenase, which impacts cellular respiration . Studies using the Immp2lKD−/− KO mouse model have shown that a deficiency in IMMP2L can lead to a decrease in total respiration .

  • Primary mouse embryonic fibroblast (MEF) cell lines derived from the Immp2lKD−/− KO mouse displayed a ~27% decrease in total respiration, comprising a ~50% decrease in nonmitochondrial respiration (NMR) and a ~12% decrease in total mitochondrial respiration .

  • IMMP2L is involved in regulating the homeostasis of the organs of the body .

  • IMMP2L enhances the structure and function of mitochondrial GPD2 dehydrogenase, which optimizes and enhances mitochondrial respiration .

Role in Disease and Aging

Mutations and deficiencies in IMMP2L have been linked to several disorders and age-associated conditions .

  • Mutation of Immp2l elevates mitochondrial membrane potential and increases superoxide production in the brain .

  • IMMP2L mutation causes early onset of age-associated disorders and impairs adult stem cell self-renewal .

  • Deficiency in Immp2l increases ischemic brain damage .

  • Common exonic deletions impacting IMMP2L have been observed in subjects screened for psychiatric conditions .

IMMP2L and Gpd2 Interaction

IMMP2L's role in cleaving and processing Gpd2 is significant for mitochondrial function . Studies indicate that the failure of IMMP2L to cleave the mitochondrial transit peptides from Gpd2 affects the glycerol phosphate shuttle (GPS) .

  • Predictive structural analysis using AlphaFold2-Multimer suggests that IMMP2L affects the structure of the Gpd2 dehydrogenase homodimer .

Effects on Organ Size and Body Composition

Research indicates that IMMP2L influences organ size and body composition .

  • Male and female Immp2lKD−/− KO mice had lower body mass compared with wildtype litter mates .

  • Male Immp2lKD−/− KO mice were shown to have a lower lean body mass compared with wildtype litter mates, while fat mass was unaffected by genotype .

  • All organs examined were observed to be smaller in size in the Immp2lKD−/− KO mouse compared with wildtype litter mates .

Mutation Distribution

Mutation TypeNumber of SamplesPercentage of Samples
Substitution - MissenseNot specified in given contextNot specified in given context
GermlineNot specified in given contextNot specified in given context
SomaticNot specified in given contextNot specified in given context

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
IMMP2L; Mitochondrial inner membrane protease subunit 2; IMP2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
IMMP2L
Target Protein Sequence
MVQSQGWVRRYFKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVKTMGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPKRWQKLESVLPPERLLVQSEEDCL
Uniprot No.

Target Background

Function
Recombinant Bovine Mitochondrial inner membrane protease subunit 2 (IMMP2L) catalyzes the removal of transit peptides necessary for targeting proteins from the mitochondrial matrix, across the inner membrane, to the intermembrane space. It is known to process the nuclear-encoded protein DIABLO.
Database Links

STRING: 9913.ENSBTAP00000005770

UniGene: Bt.5921

Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is IMMP2L and what is its primary function in mitochondria?

IMMP2L (Inner Mitochondrial Membrane Peptidase 2-Like) catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space . This enzymatic activity is critical for proper mitochondrial protein localization and function. IMMP2L is known to specifically process the nuclear-encoded protein DIABLO, which plays a role in apoptotic signaling . The protein belongs to the peptidase S26 family and functions as a key component of the mitochondrial protein import machinery.

What is the molecular weight and structure of IMMP2L?

Human IMMP2L has a calculated molecular weight of 12 kDa or 20 kDa, with an observed molecular weight of 12 kDa in experimental conditions . Recombinant human IMMP2L (amino acids 38-175) has a predicted molecular weight of 18 kDa (161 amino acids) as confirmed by MALDI-TOF analysis . The protein exists in liquid form and can be expressed with a His-tag for purification purposes . The full amino acid sequence of the recombinant human protein (aa 38-175) includes the functional domain necessary for its peptidase activity.

How conserved is IMMP2L across species, particularly between human and bovine variants?

While specific sequence identity percentages are not provided in the search results, IMMP2L shows significant conservation across mammalian species. The functional domains are likely highly conserved, allowing for cross-species research applications. The available antibodies demonstrate reactivity with human, mouse, and rat samples, suggesting structural similarity across these species . Given this conservation pattern, bovine IMMP2L likely shares significant homology with human IMMP2L, particularly in functional domains involved in peptidase activity.

What antibody dilutions and applications are recommended for IMMP2L detection?

For Western Blot applications, recommended antibody dilutions range from 1:1000 to 1:4000 . For immunohistochemistry, dilutions of 1:20 to 1:200 are suggested, with antigen retrieval using TE buffer pH 9.0 or citrate buffer pH 6.0 . Positive Western Blot detection has been reported in human kidney tissue, human heart tissue, and mouse skeletal muscle tissue . For immunocytochemistry/immunofluorescence (ICC/IF), antibodies have been successfully used at 4μg/ml concentration . It is recommended that researchers titrate antibodies in each testing system to obtain optimal results, as detection can be sample-dependent .

What are the optimal conditions for expression and purification of recombinant IMMP2L?

Recombinant IMMP2L can be successfully expressed in E. coli with a His-tag fusion . The optimal protein domain for recombinant expression typically includes amino acids 38-175, which encompasses the functional region . Purification can be performed using standard immobilized metal affinity chromatography (IMAC) methods. The purified protein can be stored in 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 50% glycerol, and 1mM DTT . Short-term storage at 2-8°C is viable for up to one week, while long-term storage requires aliquoting and freezing at -20°C to -80°C to avoid repeated freeze-thaw cycles .

How can researchers verify the purity and activity of recombinant IMMP2L?

Recombinant IMMP2L purity can be assessed using SDS-PAGE under reducing conditions, with expected purity levels >95% . Protein identity and molecular weight can be confirmed using MALDI-TOF mass spectrometry . Functional verification requires enzymatic activity assays using known substrates such as DIABLO. Researchers should include positive controls in activity assays and may need to optimize reaction conditions including pH, temperature, and cofactor requirements for bovine IMMP2L specifically.

How does IMMP2L dysfunction contribute to oxidative stress in mitochondria?

Studies with Immp2l mutant mice demonstrate that IMMP2L dysfunction leads to elevated levels of mitochondrial superoxide . These mutant mice show increased serum protein carbonyl content, cerebellar 4-hydroxynonenal (HNE), and nitrotyrosine modification compared to normal control mice . This suggests that IMMP2L plays a critical role in regulating mitochondrial reactive oxygen species (ROS) production, potentially through its involvement in processing proteins of the electron transport chain or other mitochondrial ROS-regulating enzymes. The direct mechanistic link appears to involve improper processing of proteins involved in maintaining redox balance.

What is the relationship between IMMP2L function and neurodegenerative processes?

IMMP2L mutation in mice causes age-dependent cerebellar degeneration, with significant underrepresentation of cerebellar granule neurons (CGNs) in older animals (>16 months) . Importantly, Purkinje cells and molecular layer cells are not similarly affected, suggesting cell type-specific vulnerability . The neurodegeneration involves apoptotic cell death of granule neurons, which can be prevented by treatment with the mitochondria-targeted antioxidant SkQ1 . This protective effect of antioxidant treatment provides strong evidence that IMMP2L dysfunction contributes to neurodegeneration through oxidative stress mechanisms.

How does IMMP2L dysfunction affect different cell types in the central nervous system?

The effects of IMMP2L dysfunction show striking cell type specificity within the central nervous system. In Immp2l mutant mice, cerebellar granule neurons are significantly more vulnerable to degeneration compared to Purkinje cells and molecular layer neurons . Additionally, SOD2 expression patterns differ by cell type, with increased expression in Purkinje cells but decreased expression in granule neurons of old mutant mice . These cell type-specific effects may reflect differences in metabolic demands, antioxidant defense capabilities, or dependence on specific IMMP2L substrates between neuronal populations.

What in vivo models are suitable for studying IMMP2L-related pathologies?

The Immp2l mutant mouse model has proven valuable for studying the role of oxidative stress in age-associated neurodegeneration . These mice exhibit elevated levels of mitochondrial superoxide, impaired fertility, and age-associated phenotypes including kyphosis and ataxia . Cerebellar hypoplasia and loss of cerebellar granule neurons occur in older mutant mice (>16 months), making this model particularly suitable for studying age-related neurodegeneration . The model allows for intervention studies, as demonstrated by the protective effect of the mitochondria-targeted antioxidant SkQ1 against cerebellar neurodegeneration .

How should experimental controls be designed when studying IMMP2L function?

When studying IMMP2L function, appropriate controls should include age-matched wild-type animals or cells for comparison with mutant or knockdown models. This is particularly important for age-related phenotypes, as demonstrated in studies comparing old (>16 months) Immp2l mutant mice with age-matched controls . Control experiments should include treatment with specific protease inhibitors to confirm peptidase activity. For antioxidant intervention studies, both treated and untreated groups of wild-type and mutant animals should be compared, as was done with SkQ1 treatment in Immp2l mutant mice .

What methodological approaches can assess mitochondrial dysfunction due to IMMP2L abnormalities?

To assess mitochondrial dysfunction in the context of IMMP2L abnormalities, researchers can employ multiple complementary approaches. These include measuring superoxide levels using fluorescent probes, quantifying oxidative stress markers (protein carbonyl content, HNE, nitrotyrosine) , assessing expression of mitochondrial proteins such as VDAC1 and SOD2 , evaluating mitochondrial membrane potential, and analyzing apoptotic markers. Histological examination can reveal tissue-specific effects, as demonstrated by the cerebellar degeneration observed in Immp2l mutant mice . Intervention studies with antioxidants can help establish causality between oxidative stress and observed phenotypes.

How can recombinant IMMP2L be used for substrate identification and characterization?

Recombinant IMMP2L can be employed in various experimental approaches for substrate identification and characterization. In vitro processing assays using purified recombinant IMMP2L and candidate substrate proteins can identify direct enzymatic targets. Mass spectrometry-based approaches can map precise cleavage sites and determine processing efficiency. Comparative proteomics between wild-type and IMMP2L-deficient systems can identify accumulated precursor proteins representing potential substrates. Known IMMP2L substrates like DIABLO can serve as positive controls in these assays .

What considerations are important when analyzing age-dependent effects of IMMP2L dysfunction?

Analyzing age-dependent effects of IMMP2L dysfunction requires careful experimental design and statistical approaches. Studies should include sufficient animals across different age groups, as the phenotypes in Immp2l mutant mice become apparent only in older animals (>16 months) . Longitudinal studies with repeated measures are preferable to cross-sectional approaches. Analysis should account for potential confounding variables and consider survival effects. Correlation analyses between age and markers of oxidative stress or neurodegeneration can help establish temporal relationships .

How should researchers interpret contradictory findings regarding IMMP2L expression or function?

Contradictory findings regarding IMMP2L may result from several factors including tissue-specific effects, developmental stage differences, and methodological variations. The observed differential expression of SOD2 in Purkinje cells versus granule neurons in Immp2l mutant mice exemplifies cell type-specific effects . Researchers should validate findings using multiple techniques (qPCR, Western blot, immunohistochemistry) and include appropriate positive and negative controls. Age-related effects should be considered, as phenotypes in Immp2l mutant mice are age-dependent . Different antibodies may recognize distinct epitopes, potentially leading to apparently contradictory results.

What therapeutic strategies might address IMMP2L-related pathologies?

The successful prevention of cerebellar neurodegeneration in Immp2l mutant mice using the mitochondria-targeted antioxidant SkQ1 suggests that antioxidant therapy may be effective for IMMP2L-related pathologies . This approach directly addresses the increased oxidative stress resulting from IMMP2L dysfunction. Alternative therapeutic strategies might include gene therapy to restore normal IMMP2L function, small molecule enhancers of mitochondrial quality control, or compounds that bypass defective protein processing by targeting downstream pathways. Combination approaches addressing both oxidative stress and mitochondrial dysfunction may prove most effective.

How might IMMP2L research contribute to understanding broader mechanisms of aging?

IMMP2L research provides a valuable model for investigating the oxidative stress theory of aging. The progressive nature of cerebellar degeneration in Immp2l mutant mice, along with increased markers of oxidative damage, demonstrates how mitochondrial dysfunction can drive age-related pathologies . The successful intervention with antioxidant treatment suggests potential strategies for addressing age-related conditions associated with oxidative stress . This model allows researchers to investigate the relationship between mitochondrial function, oxidative stress, and tissue-specific aging processes, potentially revealing new targets for interventions to promote healthy aging.

What emerging technologies might advance IMMP2L research?

Emerging technologies that could significantly advance IMMP2L research include CRISPR/Cas9 gene editing for creating tissue-specific or inducible knockout models, single-cell transcriptomics and proteomics to better understand cell type-specific effects, advanced imaging techniques to visualize mitochondrial dynamics in real-time, high-throughput screening approaches to identify novel IMMP2L substrates or modulators, and computational modeling to predict structure-function relationships. These technologies could help resolve current knowledge gaps and accelerate translation of findings to therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.