Recombinant Bovine Mitochondrial inner membrane protein OXA1L (OXA1L)

Shipped with Ice Packs
In Stock

Description

Introduction

OXA1L (OXA1L mitochondrial inner membrane protein) is a protein found in the inner mitochondrial membrane of eukaryotes . It belongs to the YidC/Alb3/Oxa1 membrane protein insertase family and plays a crucial role in the biogenesis of membrane proteins . OXA1L facilitates the insertion of both mitochondrial- and nuclear-encoded proteins into the inner mitochondrial membrane .

Function

  • Protein Insertion: OXA1L mediates the co-translational insertion of integral membrane proteins into the mitochondrial inner membrane .

  • Assembly of OXPHOS Complexes: It is essential for the assembly of oxidative phosphorylation (OXPHOS) complexes I, IV, and V . OXA1L interacts with mitoribosomes and is required for the co-translational membrane insertion of mitochondrial-encoded proteins such as Atp6p, Atp9p, Cox1p, Cox2p, Cox3p, and Cytb .

  • Interaction with TMEM126A: TMEM126A associates with OXA1L and mitochondrial ribosomes. The interaction between OXA1L and TMEM126A is independent of active mitochondrial translation or OXA1L association with the ribosome .

Structure and Properties

  • C-Terminal Tail: The C-terminal tail of OXA1L (Oxa1L-CTT) binds to mitochondrial ribosomes and plays a role in the co-translational insertion of mitochondria-synthesized proteins into the inner membrane .

  • Membrane Spanning: Metazoan OXA1L spans the inner membrane five times. The C-terminal domain of the protein is exposed to the mitochondrial matrix and provides the platform for binding to the mitochondrial ribosome .

  • Dynamic Distribution: Oxa1 is dynamically redistributed within the inner membrane of mitochondria. Its distribution is influenced by the availability of nuclear-encoded mitochondrial proteins, as well as by mitochondrial protein translation .

Clinical Significance

Mutations and depletion of OXA1L have been linked to mitochondrial encephalopathy and respiratory chain deficiencies .

  • OXA1L Depletion: Targeted depletion of OXA1L in human cells or Drosophila melanogaster causes defects in the assembly of complexes I, IV, and V .

  • OXA1L Variants: Defects in OXA1L can result in decreased levels of OXA1L and subunits of complexes IV and V. Expression of wild-type human OXA1L can rescue complex IV and V defects .

  • Encephalopathy: A patient with biallelic OXA1L variants presented with severe encephalopathy, hypotonia, and developmental delay and showed complex IV deficiency in skeletal muscle .

Research Findings

StudyFindings
Thompson, 2018 OXA1L is required for the assembly of multiple respiratory chain complexes. Mitochondrial protein synthesis is not affected in patient fibroblasts, but the stability of nascent polypeptides is decreased, consistent with a role for OXA1L in co-translational insertion and respiratory complex assembly.
Hennon, 2015 OXA1L is a member of the YidC/Alb3/Oxa1 membrane protein insertase family.
C-terminal Tail Properties The C-terminal tail of human Oxa1L does not form a coiled-coil helical structure in solution. The Oxa1L-CTT exists primarily as a monomer in solution but forms dimers and tetramers at high salt concentrations. The binding of Oxa1L-CTT to mitochondrial ribosomes is an enthalpy-driven process.
TMEM126A Interaction TMEM126A is associated with the OXA1L-insertase complex in mitochondria, and the interaction between OXA1L and TMEM126A is independent of active mitochondrial translation or OXA1L association with the ribosome. Loss of TMEM126A leads to the destabilization of mitochondrial translation products, triggering an inner mitochondrial membrane quality control process.
OXA1 Distribution Oxa1 is dynamically redistributed within the inner membrane of mitochondria. Its distribution is influenced by the availability of nuclear-encoded mitochondrial proteins, as well as by mitochondrial protein translation. A direct interaction of Oxa1 with the actively translating ribosome is required for the enrichment of Oxa1 in the CM under respiratory conditions. The results also suggest that the predominant localization of Oxa1 in the CM under respiratory conditions is an active mechanism driven by the interaction with the ribosome rather than a passive consequence of different protein compositions in the inner membrane.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OXA1L; Mitochondrial inner membrane protein OXA1L; Oxidase assembly 1-like protein; OXA1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
OXA1L
Target Protein Sequence
MALALMCGRRQLLCLLRPQRQFHSVAGPCQWPRKPLTAGLGFPADRCLGHPRYVLLMAPG PRGLSTSAVSFGEAQVPAPPVIPATPPPTAVPEVASGEAADVIQAAAEQSFAE
Uniprot No.

Target Background

Function

Recombinant Bovine Mitochondrial inner membrane protein OXA1L (OXA1L) is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. It is essential for the activity and assembly of cytochrome oxidase and plays a crucial role in the correct biogenesis of ATP synthase and complex I in mitochondria.

Database Links
Protein Families
OXA1/ALB3/YidC family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of OXA1L and how does it differ from its yeast homolog?

The human OXA1L protein, which shares significant homology with bovine OXA1L, consists of approximately 437 amino acids with a molecular weight of approximately 49 kDa (observed at about 42 kDa in Western blots) . Unlike its yeast homolog Oxa1p, the C-terminal tail of human OXA1L (Oxa1L-CTT) does not form a coiled-coil helical structure in solution . Instead, Oxa1L-CTT exists primarily as a monomer in solution but can form dimers and tetramers at high salt concentrations . This structural distinction has important implications for understanding species-specific differences in membrane protein insertion mechanisms and for designing experiments with recombinant bovine OXA1L.

What respiratory chain complexes depend on OXA1L for assembly and function?

Research has demonstrated that OXA1L is required for the assembly of multiple respiratory chain complexes. Evidence from patient studies and cellular models shows that OXA1L deficiency affects:

  • Complex I (NADH:ubiquinone oxidoreductase)

  • Complex IV (Cytochrome c oxidase)

  • Complex V (F₁F₀-ATP synthase)

Interestingly, the dependence on OXA1L appears to be tissue-specific. In some tissues, complex IV deficiency is most prominent, while in others, complex I deficiency may be the primary manifestation . This suggests that either differential expression of OXA1L isoforms or the presence of other unidentified insertases may compensate for OXA1L in different tissues .

How does the C-terminal tail of OXA1L interact with mitochondrial ribosomes?

The C-terminal tail of OXA1L (Oxa1L-CTT), comprising approximately 100 amino acids, binds to mitochondrial ribosomes and plays a crucial role in the co-translational insertion of mitochondria-synthesized proteins into the inner membrane . This binding is an enthalpy-driven process, suggesting specific molecular interactions rather than non-specific associations . Immunoprecipitation studies have shown enrichment of mtDNA-encoded subunits of complexes I, IV, and V when OXA1L is pulled down, confirming its direct interaction with nascent mitochondrial translation products . This interaction is essential for proper membrane insertion and subsequent assembly of respiratory chain complexes.

What experimental approaches can be used to study the interaction between recombinant bovine OXA1L and mitochondrial ribosomes?

To study OXA1L-ribosome interactions, researchers can employ several complementary approaches:

  • Purification of the C-terminal tail: Express and purify the C-terminal tail of bovine OXA1L (similar to Oxa1L-CTT) for binding studies with isolated mitochondrial ribosomes .

  • Isothermal titration calorimetry (ITC): Quantify the thermodynamic parameters of OXA1L-ribosome binding, as this interaction has been shown to be enthalpy-driven .

  • Immunoprecipitation with mass spectrometry: Pull down OXA1L from bovine mitochondria and identify interacting ribosomal proteins and nascent chains through mass spectrometry .

  • Cryo-electron microscopy: Visualize the structural interface between OXA1L and mitochondrial ribosomes to understand the molecular details of this interaction.

  • Ribosome profiling: Map the precise locations of ribosome pausing during the synthesis of OXA1L-dependent proteins to identify critical interaction points.

How can researchers distinguish between the direct and indirect effects of OXA1L deficiency on respiratory chain complex assembly?

Distinguishing direct from indirect effects requires a multi-faceted approach:

  • Rescue experiments: Express wild-type bovine OXA1L in OXA1L-deficient cells and monitor the recovery of different complex assemblies over time. Immediate recovery suggests direct dependence, while delayed recovery may indicate indirect effects .

  • Proximity labeling: Use techniques like BioID or APEX to identify proteins in close proximity to OXA1L during active translation and insertion.

  • Pulse-chase experiments: Track the incorporation of newly synthesized mitochondrial proteins into respiratory complexes in the presence and absence of functional OXA1L.

  • In vitro reconstitution: Develop proteoliposome systems with purified components to test the direct insertion activity of OXA1L for different substrate proteins.

  • Temporal analysis: Monitor the assembly intermediates that accumulate at different time points following OXA1L depletion to establish the sequence of assembly defects.

What is the role of OXA1L in mitochondrial cristae formation and how does this relate to respiratory chain complex assembly?

OXA1L has been implicated in the formation and organization of mitochondrial cristae. Serial-section tomography studies in Drosophila have shown that OXA1L localizes not only to the inner boundary membrane (IBM) but also to cristae and reticular structures isolated in the matrix . The formation of lamellar cristae is associated with the gain of cytochrome c oxidase (COX) function, with COX4 subunit predominantly localized to organized lamellar cristae .

Interestingly, 3D tomography has revealed that some COX-positive lamellar cristae are not connected to the IBM, suggesting that some cristae may form through a vesicle germination process within the matrix, rather than through invagination of the IBM . OXA1L may participate in this process by facilitating the insertion of respiratory chain components into these emerging cristae structures.

This dual role in protein insertion and cristae organization suggests that OXA1L coordinates the structural and functional maturation of mitochondria, ensuring that respiratory chain complexes are properly positioned within the cristae for optimal function.

What are the optimal conditions for expressing and purifying recombinant bovine OXA1L for functional studies?

When working with recombinant bovine OXA1L, consider the following optimization strategies:

  • Expression system selection:

    • Bacterial systems (E. coli) work well for soluble domains like the C-terminal tail

    • Insect cell or mammalian expression systems are preferable for full-length OXA1L to ensure proper membrane insertion and folding

  • Purification approach:

    • For full-length protein: Use mild detergents (DDM, digitonin) for extraction

    • For C-terminal tail: Standard affinity purification approaches with His or GST tags

    • Consider using nanodiscs or amphipols for maintaining the native-like membrane environment

  • Buffer considerations:

    • Be aware that high salt concentrations can induce oligomerization of the C-terminal tail, which may affect functional studies

    • pH optimization is critical for stability (typically pH 7.2-7.4)

    • Include appropriate protease inhibitors to prevent degradation

  • Storage conditions:

    • Flash freeze in small aliquots to avoid freeze-thaw cycles

    • For the C-terminal tail, storage at -20°C in buffer containing 50% glycerol has been reported to maintain stability

What antibodies and detection methods are most effective for studying bovine OXA1L in different experimental contexts?

Based on available information for OXA1L research:

ApplicationRecommended MethodDilution/ConditionsNotes
Western BlotPolyclonal antibody (similar to 21055-1-AP)1:2000-1:10000Observed at approximately 42 kDa
ImmunohistochemistryPolyclonal antibody1:50-1:500Antigen retrieval with TE buffer pH 9.0 or citrate buffer pH 6.0
ImmunofluorescencePolyclonal antibody1:400-1:1600Works well in cellular models like HepG2 cells
ImmunoprecipitationPolyclonal antibodyTitration requiredEffective for pulling down OXA1L complexes

For detection of bovine OXA1L specifically:

  • Confirm cross-reactivity of human antibodies with bovine protein

  • Consider generating bovine-specific antibodies if cross-reactivity is insufficient

  • For mitochondrial localization studies, combine with mitochondrial markers like TOMM20 (outer membrane) or COX4 (inner membrane)

How can researchers assess the functional impact of mutations or modifications in recombinant bovine OXA1L?

To evaluate how mutations affect OXA1L function:

  • Complementation assays: Express wild-type or mutant bovine OXA1L in OXA1L-deficient cells (either knockout models or patient-derived cells) and assess rescue of:

    • Respiratory chain complex assembly (by BN-PAGE)

    • Oxygen consumption (using Seahorse or Clark electrode)

    • ATP production

    • Cell viability under galactose medium (forcing mitochondrial ATP production)

  • In vitro insertion assays: Reconstitute the insertion process using:

    • Purified mitochondrial ribosomes

    • Isolated mitochondrial membranes or proteoliposomes

    • Radiolabeled substrate proteins

    • Wild-type or mutant OXA1L protein

  • Structural and interaction analyses:

    • Assess binding affinity to mitochondrial ribosomes (wild-type vs. mutant)

    • Evaluate oligomerization state changes using size exclusion chromatography

    • Test membrane association properties using membrane flotation assays

  • Model systems comparison:

    • Create equivalent mutations in yeast, mammalian cell lines, and Drosophila models

    • Compare phenotypes across species to identify conserved functional requirements

How should researchers interpret tissue-specific differences in OXA1L-dependent complex deficiencies?

When analyzing tissue-specific effects of OXA1L deficiency, consider:

  • Differential expression analysis: Examine OXA1L isoform expression patterns across different tissues. Available mRNA expression data suggest that brain tissue has the lowest relative expression of OXA1L , which may explain increased vulnerability.

  • Compensatory mechanisms: Investigate the presence and expression levels of other potential insertases that might partially substitute for OXA1L function in specific tissues. Recent phylogenetic analyses have identified distant homologues of Oxa1 in the eukaryotic endoplasmic reticulum (WRB/Get1, EMC3, and TMCO1) , though no additional mitochondrial insertase candidates have been identified.

  • Tissue-specific substrate requirements: Different tissues may have varying dependencies on specific respiratory chain complexes. For instance, patient data showed complex IV deficiency in skeletal muscle but complex I deficiency in the central nervous system .

  • Methodological considerations:

    • Enzymatic assays may not detect all defects (e.g., complex V defects were not assessed by enzymatic assay but were visible by Western blotting and BN-PAGE)

    • Different detection methods may have varying sensitivities for each complex

What experimental controls are essential when studying the effects of OXA1L knockdown or overexpression?

When manipulating OXA1L levels, include these essential controls:

  • For knockdown studies:

    • Non-targeting siRNA/shRNA controls

    • Rescue with siRNA/shRNA-resistant wild-type OXA1L to confirm specificity

    • Monitoring of other mitochondrial proteins to rule out general mitochondrial degradation

    • Assessment of mitochondrial mass and membrane potential

  • For overexpression studies:

    • Empty vector controls

    • Expression of unrelated mitochondrial protein at similar levels

    • Careful titration of expression levels to avoid artifacts from massive overexpression

    • Assessment of potential dominant-negative effects

  • For both approaches:

    • Time-course analyses to distinguish primary from secondary effects

    • Multiple cell types to identify cell-specific responses

    • Multiple readouts of mitochondrial function (not just respiratory chain complex levels)

  • Validation across methods:

    • Confirm key findings using alternative approaches (e.g., CRISPR knockout vs. siRNA)

    • Use complementary techniques to assess complex assembly (BN-PAGE, immunoprecipitation, enzymatic activity)

How can researchers determine if observed phenotypes in OXA1L-deficient models are directly due to defects in protein insertion versus secondary effects on mitochondrial structure?

Differentiating between direct insertion defects and secondary structural effects requires:

  • Temporal analysis: Monitor the sequence of events following OXA1L depletion:

    • Early changes likely represent direct effects on protein insertion

    • Later changes may reflect secondary structural adaptations

  • Substrate-specific insertion assays: Track the insertion of known OXA1L substrates using:

    • Radiolabeled precursors

    • Protease protection assays

    • Membrane fractionation studies

  • Structure-function studies: Generate OXA1L variants with:

    • Mutations that specifically affect ribosome binding but not membrane insertion

    • Mutations that affect insertion activity but preserve structural roles

    • Compare phenotypes to distinguish function-specific effects

  • Correlative microscopy approaches: Combine functional and structural analyses:

    • Serial-section electron tomography to visualize cristae morphology

    • Immunogold labeling to localize respiratory chain components

    • Correlate structural changes with biochemical defects in the same samples

  • In vitro reconstitution: Isolated membrane systems can help determine if OXA1L directly mediates insertion of specific substrates or has additional roles in membrane organization.

What approaches might identify additional substrates and interaction partners of bovine OXA1L?

To discover new OXA1L substrates and interactors:

  • Proximity-based labeling: Apply BioID or APEX2 tagging to OXA1L to identify proteins in its immediate vicinity during active translation.

  • Crosslinking mass spectrometry: Use chemical crosslinkers followed by mass spectrometry to capture transient interactions during the insertion process.

  • Ribosome profiling with OXA1L depletion: Identify transcripts whose translation is specifically affected by OXA1L absence.

  • Comparative proteomics: Analyze changes in membrane protein composition following OXA1L depletion or mutation.

  • Genetic interaction screens: Perform synthetic lethal or synthetic sick screens to identify genes that functionally interact with OXA1L.

How might understanding OXA1L function contribute to therapeutic approaches for mitochondrial disorders?

Research on OXA1L has several potential therapeutic implications:

  • Gene therapy approaches: OXA1L gene supplementation could potentially rescue defects in patients with OXA1L mutations .

  • Small molecule screening: Identify compounds that can enhance residual OXA1L activity or stabilize partially functional OXA1L variants.

  • Bypass strategies: Develop approaches to promote alternative insertion pathways that might compensate for OXA1L deficiency in affected tissues.

  • Biomarker development: Use understanding of tissue-specific OXA1L functions to develop targeted biomarkers for mitochondrial disorders.

  • Precision medicine: Knowledge of how specific OXA1L variants affect different substrates could guide personalized therapeutic approaches for patients with mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.