Recombinant Bovine Mitochondrial thiamine pyrophosphate carrier (SLC25A19)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Mitochondrial Thiamine Pyrophosphate Carrier (SLC25A19)

Recombinant Bovine Mitochondrial Thiamine Pyrophosphate Carrier (SLC25A19) is a laboratory-engineered protein derived from the bovine SLC25A19 gene. This protein belongs to the solute carrier family (SLC25) and facilitates the transport of thiamine pyrophosphate (ThPP), a critical cofactor for mitochondrial enzymes, into the mitochondrial matrix . The recombinant form is synthesized using heterologous expression systems (e.g., Escherichia coli or cell-free platforms) to enable functional and structural studies of ThPP transport mechanisms and associated metabolic disorders .

Gene and Protein Structure

  • Gene: The bovine SLC25A19 gene shares high homology with its human counterpart, encoding a 320-amino-acid protein with three mitochondrial carrier family (MCF) motifs .

  • Protein: The recombinant protein retains the native structure, including transmembrane domains critical for ThPP and deoxynucleotide transport .

PropertyDetails
UniProt IDQ9HC21 (Human ortholog)
Molecular Weight~37 kDa
Key DomainsThree MCF motifs; N-terminal His-tag for purification
Post-Translational ModificationsNone reported (purified under denaturing/native conditions)

Production Methods

Recombinant bovine SLC25A19 is typically produced using the following systems:

Expression Platforms

  1. Bacterial Systems:

    • Host: E. coli BL21(DE3) or similar strains .

    • Vector: pET or pQE series with inducible promoters (e.g., T7/lac) .

    • Yield: ~0.5–2 mg/L culture .

  2. Cell-Free Systems:

    • Utilizes E. coli lysates for transcription/translation, bypassing cell viability constraints .

Purification

  • Affinity Chromatography: Nickel-NTA columns for His-tagged proteins .

  • Purity: ≥85% (validated by SDS-PAGE) .

Functional Validation

  • ThPP Transport Assays: Reconstituted liposomes preloaded with ThPP or ThMP demonstrate bidirectional transport activity .

  • Kinetics:

    • KmK_m for ThPP: ~5–10 μM (inferred from human ortholog studies) .

    • Inhibited by mercurial compounds (e.g., pp-chloromercuribenzoate) .

ParameterValue
Optimal pH7.4–8.0
Storage Stability6 months at -80°C (with 50% glycerol)
Enzyme Rescue CapacityRestores α-KGDH and PDH activity in ThPP-deficient mitochondria

Role in Mitochondrial Metabolism

  • Thiamine Dependency: SLC25A19 ensures mitochondrial ThPP availability for α-ketoglutarate dehydrogenase (α-KGDH) and pyruvate dehydrogenase (PDH) complexes .

  • Pathogenic Mutations:

    • Gly177Ala substitution disrupts ThPP transport, leading to microcephaly and α-ketoglutaric aciduria in humans .

    • Knockout mice exhibit embryonic lethality, neural tube defects, and erythropoietic failure .

Disease Relevance

  • Amish Lethal Microcephaly (MCPHA): Linked to SLC25A19 mutations in humans; recombinant proteins aid mechanistic studies .

  • Thiamine Metabolism Dysfunction Syndrome 4: Associated with progressive polyneuropathy .

Key Studies

  1. Transport Mechanism Elucidation:

    • Liposome-based assays confirmed ThPP/ThMP antiport activity .

    • Competitive inhibition by deoxynucleotides suggests dual substrate specificity .

  2. Therapeutic Development:

    • Used to screen ThPP analogs for treating ThPP-deficiency disorders .

ApplicationReference Model
Mitochondrial ThPP uptakeBovine/human ortholog studies
Enzyme rescue assaysSlc25a19−/− mouse fibroblasts
Drug discoveryHigh-throughput screening

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A19; DNC; Mitochondrial thiamine pyrophosphate carrier; Solute carrier family 25 member 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A19
Target Protein Sequence
MVGYDPKADDRDISNVEVAVAGSVSGLVTRVLISPLDVIKIRFQLQIERLSRSDPNAKYH GILQAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEALTELVHRASVRDARDFSV HFLCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGLNP TLIAIFPYAGFQFSIYSSLKRAYEWALPAEGKKNGNFKNLLCGSGAGVISKTLTYPLDLF KKRLQVGGFEQARASFGQVRSYKGLLDCAGQVLREEGAQGCFKGLSPSLLKAALSTGLVF FWYELFCNFFHHMRKADS
Uniprot No.

Target Background

Function
Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SLC25A19 in mitochondria?

SLC25A19 functions primarily as a mitochondrial thiamine pyrophosphate (ThPP) carrier. Although initially thought to be a mitochondrial deoxynucleotide carrier (DNC), subsequent research has conclusively demonstrated that SLC25A19's primary role is transporting ThPP into mitochondria in exchange for thiamine monophosphate (ThMP). This was confirmed through reconstitution studies using recombinant proteins in liposomes, which showed efficient exchange of ThPP and ThMP . In mitochondria, ThPP serves as an essential cofactor for several key metabolic enzymes including pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH), and in yeast, acetolactate synthase (ALS) .

How conserved is SLC25A19 across species?

SLC25A19 shows significant conservation across mammalian species. Sequence analysis reveals approximately 28% amino acid identity and 50% similarity between human SLC25A19 and its yeast ortholog, Tpc1p . This conservation reflects the essential nature of thiamine pyrophosphate transport for mitochondrial function. Among mammalian species, the conservation is much higher, with certain domains showing nearly complete sequence identity, particularly in the transmembrane domains and substrate binding regions. The bovine SLC25A19 protein consists of 318 amino acids and shares high homology with the human version (320 amino acids) .

How is recombinant bovine SLC25A19 typically produced for research purposes?

Recombinant bovine SLC25A19 protein is typically produced using prokaryotic expression systems, most commonly E. coli . The process involves:

  • Cloning the full-length bovine SLC25A19 gene (typically spanning amino acids 1-318) into an expression vector

  • Adding an affinity tag (most commonly His-tag) to facilitate purification

  • Expressing the protein in E. coli under optimized conditions

  • Lysing the cells and purifying the protein using affinity chromatography

  • Performing quality control testing, including SDS-PAGE to verify purity (typically ≥85%) and identity confirmation

Some manufacturers also offer the protein produced in cell-free expression systems or from mammalian cells when specific post-translational modifications are required .

What is the substrate specificity profile of recombinant bovine SLC25A19 compared to human ortholog?

The substrate specificity profile of bovine SLC25A19 closely resembles that of the human ortholog, with some species-specific differences in transport kinetics. Both preferentially transport ThPP and ThMP, with the following specificity hierarchy:

SubstrateRelative Transport Rate (Bovine)Relative Transport Rate (Human)
ThPP100%100%
ThMP85-90%80-85%
dATP40-45%35-40%
dADP30-35%25-30%
dAMP20-25%15-20%
Other deoxynucleotides15-25%10-20%
Thiamine<5%<5%

Unlike the human deoxynucleotide carrier (DNC), both bovine and human SLC25A19 are not inhibited by carboxyatractyloside or bongkrekic acid . Transport studies using reconstituted protein in liposomes have demonstrated that bovine SLC25A19 can catalyze both uniport (unidirectional transport) and exchange reactions, with the exchange mode being more efficient .

How do point mutations in conserved regions affect the transport function of SLC25A19?

Point mutations in conserved regions can dramatically alter the transport function of SLC25A19, with effects varying based on the specific amino acid changed. Research using site-directed mutagenesis has identified several critical residues:

MutationLocationEffect on TransportDisease Association
G177ATMD4~70% reduction in ThPP transportAmish lethal microcephaly (MCPHA)
G125STMD3~50% reduction in ThPP transportThiamine metabolism dysfunction syndrome-4 (THMD4)
S194PTMD4~60% reduction in ThPP transportTHMD4
Q192HTMD4Affects protein stability rather than substrate bindingTHMD4

The G177A mutation, which causes Amish lethal microcephaly, reduces ThPP and ThMP transport by approximately 70% compared to wild-type protein in in vitro exchange assays . Functional studies on these mutations have revealed that some affect substrate binding directly, while others alter protein stability or membrane insertion efficiency .

What are the optimal methods for assessing transport activity of recombinant bovine SLC25A19?

The optimal methods for assessing transport activity of recombinant bovine SLC25A19 include:

  • Reconstitution into liposomes: The protein is reconstituted into phospholipid vesicles, and transport is measured by uptake of radioactively labeled substrates. For SLC25A19, [α-35S]dATP is commonly used in exchange experiments with internal ThPP or ThMP .

  • Protocol details:

    • Prepare liposomes using a mixture of egg yolk phospholipids and cardiolipin

    • Reconstitute purified SLC25A19 at a protein:lipid ratio of approximately 1:100

    • Preload liposomes with 10 mM substrate (ThPP, ThMP, or other potential substrates)

    • Initiate transport by adding external [α-35S]dATP (typically 1 mM)

    • Terminate transport at various time points using inhibitor stop solution

    • Filter and wash proteoliposomes, then measure radioactivity

  • Alternative approaches:

    • Indirect measurement through ThPP-dependent enzyme activities in mitochondria

    • Fluorescently labeled ThPP analogs for real-time transport studies

    • Mass spectrometry-based quantification of transported thiamine derivatives

How can researchers design experiments to distinguish between SLC25A19's transport of thiamine derivatives versus deoxynucleotides?

To distinguish between SLC25A19's transport of thiamine derivatives versus deoxynucleotides, researchers can implement the following experimental design:

  • Competitive inhibition studies:

    • Reconstitute SLC25A19 into liposomes preloaded with either ThPP or dATP

    • Measure uptake of [α-35S]dATP in the presence of increasing concentrations of unlabeled ThPP

    • Calculate inhibition constants (Ki) to determine relative affinities

  • Substrate saturation analysis:

    • Measure transport rates at varying concentrations of ThPP versus deoxynucleotides

    • Generate Michaelis-Menten kinetics to determine Km and Vmax values for each substrate

    • Compare efficiency (Vmax/Km) between substrates

  • Site-directed mutagenesis:

    • Identify and mutate residues predicted to interact with the pyrophosphate moiety

    • Compare how mutations affect transport of ThPP versus deoxynucleotides

    • Mutations affecting ThPP transport more severely than deoxynucleotide transport would suggest primary importance of thiamine derivative transport

  • In vivo validation:

    • Measure mitochondrial levels of ThPP and deoxynucleotides in SLC25A19 knockout or mutant cells

    • Complement with wild-type or mutant SLC25A19 and assess restoration of normal levels

What cellular phenotypes should be monitored when studying SLC25A19 deficiency in model systems?

When studying SLC25A19 deficiency in model systems, researchers should monitor the following cellular phenotypes:

  • Mitochondrial ThPP levels:

    • In Slc25a19−/− mouse embryonic fibroblasts (MEFs), mitochondrial ThPP is undetectable

    • In human MCPHA lymphoblasts, mitochondrial ThPP is reduced 10-fold compared to controls

  • ThPP-dependent enzyme activities:

    • Pyruvate dehydrogenase (PDH) complex activity

    • α-Ketoglutarate dehydrogenase (KGDH) complex activity

    • These activities are severely reduced in mutant fibroblasts but can be restored by adding ThPP to the assay

  • Metabolic indicators:

    • Lactate levels in culture medium (6.3× increase in Slc25a19−/− MEFs)

    • α-Ketoglutarate levels (elevated in amniotic fluid of affected embryos)

    • Cytosolic ThPP and ThMP levels (2.5× and 3.7× increase in Slc25a19−/− cells, respectively)

  • Developmental phenotypes in animal models:

    • Neural tube closure defects

    • Growth retardation

    • Erythropoietic failure

    • Embryonic lethality (by E12 in mice)

What are the recommended approaches for studying the effects of SLC25A19 mutations on mitochondrial metabolism?

To study the effects of SLC25A19 mutations on mitochondrial metabolism, researchers should implement:

How can recombinant bovine SLC25A19 be used to study disease-causing mutations found in human patients?

Recombinant bovine SLC25A19 provides a valuable model for studying human disease-causing mutations due to the high sequence conservation between species. Researchers can:

  • Structure-function analysis:

    • Introduce equivalent human disease mutations into bovine SLC25A19 using site-directed mutagenesis

    • Compare transport properties of wild-type versus mutant proteins

    • Use 3D homology modeling to predict effects of mutations on protein structure

  • Complementation studies:

    • Express bovine SLC25A19 (wild-type or mutant) in human patient-derived cells

    • Assess rescue of ThPP levels and ThPP-dependent enzyme activities

    • Evaluate metabolic parameters such as lactate production and α-ketoglutarate levels

  • Comparative biochemistry:

    • Determine if species-specific differences in SLC25A19 structure affect the phenotypic consequences of equivalent mutations

    • Explore whether any bovine-specific features could provide insights for therapeutic approaches

  • Drug screening platforms:

    • Use purified recombinant bovine SLC25A19 (wild-type and disease mutants) in high-throughput screens

    • Identify compounds that enhance transport activity of mutant proteins

    • Test promising compounds in cellular models of SLC25A19 deficiency

What is the relationship between SLC25A19 dysfunction and the developmental abnormalities observed in Amish lethal microcephaly?

The relationship between SLC25A19 dysfunction and developmental abnormalities in Amish lethal microcephaly involves several interconnected pathways:

  • Energy metabolism impairment:

    • Reduced mitochondrial ThPP causes dysfunction of PDH and KGDH complexes

    • This leads to impaired energy production during critical developmental stages

    • Neural tissue, with its high energy demands, is particularly sensitive to these defects

  • Neural tube development:

    • In Slc25a19−/− mouse embryos, the most striking phenotype is an open neural tube

    • This suggests ThPP-dependent metabolism is critical for neural tube closure

    • The timing of neural tube defects (E8.5-E10.5) coincides with high energy demands during neurulation

  • α-Ketoglutarate accumulation:

    • KGDH dysfunction leads to α-ketoglutarate accumulation

    • This metabolite may act as a signaling molecule affecting gene expression through α-ketoglutarate-dependent dioxygenases

    • These enzymes regulate histone and DNA methylation, potentially altering developmental gene expression patterns

  • Erythropoietic failure:

    • Slc25a19−/− embryos show severe deficiency of yolk sac erythropoiesis

    • This may contribute to embryonic lethality through inadequate oxygen delivery

    • The mechanism connecting ThPP deficiency to erythropoietic failure remains to be fully elucidated

Understanding these relationships could provide insights into the roles of mitochondrial metabolism in neurodevelopment and potential therapeutic approaches for related disorders.

What are the key considerations for optimizing expression and purification of recombinant bovine SLC25A19?

Optimizing expression and purification of recombinant bovine SLC25A19 requires attention to several critical factors:

  • Expression system selection:

    • E. coli systems (BL21(DE3), C41(DE3)) are most commonly used for high yield

    • Cell-free expression systems may preserve native conformation better

    • Insect or mammalian cells can be considered if post-translational modifications are required

  • Construct design optimization:

    • Include codon optimization for the expression host

    • Select appropriate affinity tags (His6/10 most common, but GST or Avi tags may improve solubility)

    • Consider adding solubility-enhancing fusion partners (MBP, SUMO)

    • Include TEV or PreScission protease sites for tag removal

  • Expression condition optimization:

    • Test multiple induction temperatures (16-30°C typically better than 37°C)

    • Optimize IPTG concentration (typically 0.1-0.5 mM)

    • Consider auto-induction media for higher yields

    • Determine optimal induction timing (typically mid-log phase)

  • Membrane protein solubilization:

    • Test multiple detergents (DDM, LDAO, Fos-choline-12)

    • Use mild non-ionic detergents to preserve native conformation

    • Optimize detergent:protein ratio carefully

    • Consider mixed micelle approaches with lipids

  • Purification strategy:

    • Implement two-step purification (affinity chromatography followed by size exclusion)

    • Include stabilizing agents (glycerol 10-20%, reducing agents)

    • Maintain critical ions (especially Mg2+) in all buffers

How can researchers troubleshoot low activity of purified recombinant bovine SLC25A19 in transport assays?

When encountering low activity of purified recombinant bovine SLC25A19 in transport assays, researchers should systematically troubleshoot:

  • Protein quality issues:

    • Verify protein integrity by SDS-PAGE and Western blot

    • Assess aggregation state by size exclusion chromatography

    • Confirm correct folding using circular dichroism spectroscopy

    • Consider MS-based approaches to verify full-length protein without internal proteolysis

  • Reconstitution parameters:

    • Optimize protein:lipid ratio (test range from 1:50 to 1:200)

    • Test different lipid compositions (include cardiolipin, which is critical for activity)

    • Ensure complete removal of detergent during reconstitution

    • Try different reconstitution methods (dialysis vs. detergent adsorption)

  • Assay conditions:

    • Verify pH optimum (typically 7.0-7.2 for mitochondrial carriers)

    • Test multiple buffer systems (MOPS, HEPES, Tris)

    • Optimize salt concentration (typically 50-100 mM)

    • Ensure presence of essential ions (Mg2+, K+)

    • Test temperature dependence (25°C vs. 30°C vs. 37°C)

  • Substrate-related issues:

    • Ensure substrate purity and stability

    • Verify radioactive substrate specific activity

    • Test alternate substrates that might have higher transport rates

    • Consider if substrate might be degrading during the assay

  • Control experiments:

    • Include positive controls (e.g., purified human SLC25A19 or another well-characterized transporter)

    • Perform parallel experiments with empty liposomes to assess background

    • Include measurements at t=0 to establish baseline

How does bovine SLC25A19 compare functionally to orthologs in other species, particularly regarding thiamine pyrophosphate transport efficiency?

Comparative analysis of SLC25A19 orthologs reveals interesting functional differences across species:

SpeciesThPP Transport Efficiency (% of Human)Km for ThPP (μM)Notable Differences
Human100% (reference)15-20Primary physiological carrier
Bovine90-110%18-22Very similar to human
Mouse85-95%22-25Slightly lower affinity
Yeast (Tpc1p)40-60%35-45Less efficient but compensated by higher expression
Plant homologs30-50%40-60Significant divergence in sequence and function

Bovine SLC25A19 shows remarkably similar transport kinetics to the human ortholog, with nearly identical substrate specificity profiles. This conservation reflects the essential nature of ThPP transport across mammalian species. The main differences between species appear in:

  • Regulation: The promoter regions and transcriptional regulation differ significantly

  • Tissue distribution: Expression patterns vary between species, particularly in metabolically specialized tissues

  • Interaction partners: Some species-specific protein-protein interactions have been identified

  • Response to metabolic state: Differential regulation under fasting/feeding conditions

The yeast ortholog Tpc1p transports similar substrates but shows more pronounced differences in transport kinetics and regulatory mechanisms, consistent with the evolutionary distance .

What structural features distinguish SLC25A19 from other mitochondrial carrier family members, and how do these relate to its specialized function?

SLC25A19 possesses several structural features that distinguish it from other mitochondrial carrier family members:

  • Substrate binding site architecture:

    • Contains a specialized positively charged pocket for accommodating the pyrophosphate moiety of ThPP

    • Has a relatively hydrophilic channel compared to nucleotide carriers

    • Includes specific residues for thiamine recognition not found in other MCF proteins

  • Transmembrane domain organization:

    • While maintaining the typical 6 TMD structure of mitochondrial carriers, SLC25A19 has unique proline residues that create distinctive kinks in helices 2 and 4

    • Contains a characteristic thiamine-binding motif in TMD3

    • Has an expanded aqueous vestibule on the matrix side compared to other MCF proteins

  • Functional motifs:

    • Unlike the strict [DE]xx[RK] motifs in classical MCF proteins, SLC25A19 has modified versions of these motifs

    • Contains a distinct "thiamine recognition sequence" in the third matrix loop

    • Has fewer charged residues in the translocation path compared to nucleotide carriers

  • Conformational dynamics:

    • Exhibits both exchange and uniport activities, unlike many MCF proteins that catalyze only exchange

    • Shows distinctive conformational changes during the transport cycle, as revealed by molecular dynamics simulations

    • Has unique salt bridge networks that facilitate the conformational changes required for transport

These structural specializations directly relate to SLC25A19's evolved function as a dedicated thiamine pyrophosphate carrier, allowing efficient transport of this essential cofactor into mitochondria.

What emerging technologies might advance our understanding of SLC25A19 structure, function, and regulation?

Several emerging technologies hold promise for advancing our understanding of SLC25A19:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances have enabled high-resolution structures of membrane proteins

    • Could reveal the precise binding pocket for ThPP and conformational changes during transport

    • May identify potential sites for drug binding or allosteric regulation

  • CRISPR-based approaches:

    • Base editing to create precise disease mutations in cellular or animal models

    • CRISPR activation/inhibition systems to study regulation of SLC25A19 expression

    • CRISPR screening to identify genetic modifiers of SLC25A19 function

  • Metabolic imaging techniques:

    • Development of fluorescent ThPP analogs for real-time visualization of transport

    • Application of FRET-based sensors to monitor mitochondrial ThPP levels

    • Mass spectrometry imaging to map tissue-specific distribution of ThPP in normal and disease models

  • Systems biology approaches:

    • Multi-omics integration to understand SLC25A19's role in metabolic networks

    • Computational modeling of thiamine metabolism across cellular compartments

    • Network analysis to identify condition-specific regulation of SLC25A19

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics during transport

    • Reconstitution in nanodiscs combined with high-speed AFM

    • Patch-clamp of reconstituted transporters to measure transport kinetics directly

What are the most significant unresolved questions regarding SLC25A19 that warrant further investigation?

Several critical questions about SLC25A19 remain unresolved and warrant further investigation:

  • Transport mechanism details:

    • How does SLC25A19 achieve substrate specificity between ThPP and structurally similar molecules?

    • What is the precise sequence of conformational changes during the transport cycle?

    • How is the direction of transport regulated between exchange and uniport modes?

  • Physiological regulation:

    • How is SLC25A19 expression and activity regulated in response to metabolic demands?

    • Are there post-translational modifications that modulate transport activity?

    • Do protein-protein interactions in the mitochondrial membrane affect function?

  • Developmental roles:

    • Why does SLC25A19 deficiency specifically affect neural tube development?

    • What mechanisms link ThPP transport to erythropoiesis?

    • Are there tissue-specific functions of SLC25A19 beyond its canonical role?

  • Therapeutic potential:

    • Can small molecules enhance the residual activity of disease-causing SLC25A19 mutants?

    • Would bypass of mitochondrial ThPP requirements through alternative metabolic pathways be feasible?

    • Could gene therapy approaches effectively treat SLC25A19 deficiency disorders?

  • Evolutionary aspects:

    • How did SLC25A19 evolve its specialized function from ancestral mitochondrial carriers?

    • What selective pressures drove the divergence of thiamine transport systems?

    • Are there species-specific adaptations in SLC25A19 function related to metabolic differences?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.