Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPMQAAASAQYR
GVLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGAGRRYQSTVEAYKTIAREEGFRGLWKGTS
PNVARNAIVNCAELVTYDLIKDTLLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
ARASREAPF
Uniprot No.
Target Background
Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane. This uncoupling disconnects oxidative phosphorylation from ATP synthesis, resulting in energy dissipation as heat.
Gene References Into Functions
- While UCPs exhibit uncoupling properties when expressed in mitochondria, uncoupling by UCP1 or UCP2 does not prevent acute substrate-driven endothelial cell superoxide as effluxed from mitochondria respiring in vitro. PMID: 15339748
- This study investigates the correlation between uncoupling protein 2 and 3 expression, mitochondrial DNA SNPs, and residual feed intake (RFI) in Angus steers selected for high or low RFI. PMID: 16775060
- The effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle are reported. PMID: 17785604
- These findings suggest that UCP2 plays a significant role in lipid and energy metabolism within mammary epithelial cells. PMID: 18706890
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
