Recombinant Bovine Mitochondrial uncoupling protein 3 (UCP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
UCP3
Target Protein Sequence
MVGLQPSERPPTTSVKFLAAGTAACFADLLTFPLDTAKVRLQIQGENQAALAARSAQYRG VLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASIRIGLYDSVKQFYTPKGSDHSSIITRI LAGCTTGAMAVTCAQPTDVVKIRFQASMHTGLGGNRKYSGTMDAYRTIAREEGVRGLWKG ILPNITRNAIVNCGEMVTYDIIKEKLLDYHLLTDNFPCHFVSAFGAGFCATLVASPVDVV KTRYMNSPPGQYHSPFDCMLKMVTQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQMKRAL MKVQMLRDSPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, decoupling oxidative phosphorylation. Consequently, energy is dissipated as heat. UCP3 may play a role in the modulation of tissue respiratory control. It participates in thermogenesis and energy balance.
Gene References Into Functions
  1. This study aimed to estimate allele and genotype frequencies of the IGF-IR/TaqI, m-calpain/HhaI, and UCP-3/BglI polymorphisms and to determine their association with growth traits in Chinese indigenous cattle breeds. PMID: 20857204
  2. This study evaluated the relationships between uncoupling protein 2 and 3 expression, mitochondrial DNA SNP, and residual feed intake (RFI) in Angus steers selected for high or low RFI. PMID: 16775060
  3. This study reports the effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle. PMID: 17785604
Database Links

KEGG: bta:281563

STRING: 9913.ENSBTAP00000006918

UniGene: Bt.136

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does UCP3 expression differ across tissues and under different physiological conditions?

UCP3 is predominantly expressed in skeletal muscle and to a lesser extent in brown adipose tissue. Unlike UCP1, which is almost exclusively expressed in brown adipose tissue, UCP3's tissue-specific expression pattern suggests specialized functions related to muscle metabolism . Expression levels of UCP3 are significantly influenced by physiological conditions. Several studies have demonstrated that UCP3 expression increases during conditions of elevated fatty acid availability, such as fasting and high-fat feeding . Exercise training has also been shown to affect UCP3 expression, though the directionality depends on the intensity and duration of exercise regimens. Cold exposure similarly can induce UCP3 expression, particularly in tissues involved in thermogenesis, suggesting its complementary role to UCP1 in temperature regulation . The dynamic regulation of UCP3 expression across different metabolic states indicates its importance in adapting mitochondrial function to changing energy demands and substrate availability.

What are the distinguishing biochemical characteristics of UCP3 compared to other UCPs?

UCP3 shares significant structural homology with other members of the mitochondrial carrier family, particularly UCP1 and UCP2, but exhibits distinct biochemical properties. Recombinant UCP3 has been shown to have a different substrate specificity profile compared to UCP2 . While both proteins transport aspartate and malate, UCP3 does not transport malonate (a three-carbon dicarboxylate) which is transported by UCP2 . A defining characteristic of UCP3 is its strict exchange transport mode - it cannot catalyze unidirectional transport of any metabolites, unlike UCP2 . UCP3 also has approximately sevenfold higher transport affinity for aspartate compared to UCP2 . In terms of proton transport capacity, reconstituted UCP3 demonstrates a rate of 2.6 protons per second, which is similar to UCP2 (4.5/s) but significantly lower than UCP1 (13.5/s) . These biochemical differences suggest that despite structural similarities, UCP3 likely serves distinct physiological functions from other UCPs, potentially related to its tissue-specific expression pattern.

What are the optimal methods for expressing and purifying recombinant bovine UCP3?

For efficient expression and purification of recombinant bovine UCP3, a bacterial expression system using E. coli strains like C0214(DE3) has proven effective based on protocols developed for human UCP3 . The protein typically accumulates as inclusion bodies, which can be isolated and purified through centrifugation on a sucrose gradient. Researchers should expect a single band with an apparent molecular mass of approximately 33 kDa when analyzed by SDS-PAGE . The inclusion bodies must be carefully solubilized and refolded to obtain functional protein. During expression, IPTG induction should be precisely controlled, and samples should be collected before and after induction to confirm successful expression . For protein functionality, it is critical to maintain proper refolding conditions that preserve the native conformation of the six transmembrane α-helices characteristic of mitochondrial carrier proteins. Purification under denaturing conditions followed by controlled refolding has been successfully applied to human UCP3 and can be adapted for bovine UCP3. The inclusion of appropriate detergents during purification and stabilizing agents during refolding is essential to obtain functionally active protein suitable for reconstitution into liposomes for subsequent transport assays.

How can researchers effectively reconstitute UCP3 into liposomes for functional studies?

Reconstitution of UCP3 into liposomes requires careful attention to lipid composition, protein-to-lipid ratio, and reconstitution conditions to ensure functional integration. Based on successful protocols for human UCP3, researchers should begin with a mixture of egg yolk phospholipids to form liposomes . The purified UCP3 protein should be combined with these lipids at a protein-to-lipid ratio of approximately 1:100 by weight, though this may require optimization for bovine UCP3. The mixture should be subjected to cycles of freeze-thawing followed by extrusion through polycarbonate filters to obtain uniformly sized proteoliposomes. For transport assays, these proteoliposomes should be preloaded with appropriate substrates at concentrations around 10 mM, while external substrate concentrations are typically maintained at 1 mM during exchange experiments . To confirm successful reconstitution, researchers should perform parallel experiments with known transport inhibitors such as pyridoxal-5'-phosphate or bathophenanthroline, which should completely abolish transport activity when properly incorporated . Additionally, controls using mutated versions of UCP3, such as the R282Q mutant which abolishes transport activity, can serve as valuable negative controls to ensure observed transport activities are specifically mediated by functional UCP3 .

What methods are most suitable for measuring UCP3-mediated substrate transport?

To accurately measure UCP3-mediated substrate transport, radioisotope-based transport assays have proven highly effective . For aspartate transport studies, [14C]-labeled aspartate can be used to track substrate movement across proteoliposomal membranes. The basic protocol involves initiating transport by adding labeled substrate to UCP3-containing proteoliposomes preloaded with potential exchange substrates . Transport is terminated at predetermined time points by adding specific inhibitors or by rapid filtration and washing to remove external substrate. The amount of radioactivity retained within proteoliposomes can then be quantified by liquid scintillation counting . For kinetic analyses, researchers should perform time-course experiments and vary substrate concentrations to determine transport rates and substrate affinities. Careful consideration must be given to control experiments, including measurements with empty liposomes and proteoliposomes containing transport-inactive UCP3 mutants (e.g., R282Q) . Additionally, substrate specificity can be comprehensively assessed by performing competition experiments, where unlabeled substrates compete with radiolabeled substrates for transport. This approach allows for comparison of relative transport affinities for different metabolites. For proton transport studies, fluorescent pH-sensitive probes or patch-clamp techniques on reconstituted membranes provide complementary approaches for assessing UCP3's potential uncoupling activity .

How does the structure-function relationship of UCP3 determine its substrate specificity and transport mechanism?

The structure-function relationship of UCP3 plays a crucial role in determining its unique substrate specificity and transport mechanism. Current structural models of UCP3, based on homology with other mitochondrial carriers, suggest six transmembrane α-helices arranged in a barrel-like configuration . The specific amino acid residues lining the translocation pathway are critical for substrate recognition and transport. Particularly important is the conserved arginine residue (R282) in the sixth transmembrane helix, as mutation to glutamine (R282Q) completely abolishes transport activity . This suggests that this positively charged residue is essential for interaction with negatively charged substrates such as aspartate and malate. Unlike UCP2, UCP3 only catalyzes an exchange transport mode and cannot perform unidirectional substrate transport, indicating fundamental differences in the conformational changes or energy coupling mechanisms between these homologous proteins . The substrate-binding site depth has been estimated at approximately 1.27 nm from the membrane surface based on atomic force microscopy studies of the related UCP1 . This structural feature likely influences accessibility to substrates and regulatory molecules like nucleotides from different sides of the membrane. Further structural studies using cryo-electron microscopy or X-ray crystallography would provide invaluable insights into the precise molecular mechanisms underlying UCP3's strict exchange transport mode and substrate selectivity.

How do post-translational modifications affect UCP3 function and regulation?

Post-translational modifications (PTMs) significantly impact UCP3 function and regulation, though this area remains less explored compared to other aspects of UCP3 biology. Phosphorylation represents one of the most studied PTMs affecting UCP3 activity. Several kinases, including PKA and AMPK, have been implicated in UCP3 phosphorylation, potentially affecting its transport activity and stability . The interaction between UCP3 and regulatory nucleotides is another critical regulatory mechanism. UCP3 reconstituted in bilayer membranes is completely inhibited by all purine nucleotides, regardless of phosphorylation level, though the inhibitory concentration (IC50) increases as phosphorylation decreases . This suggests a complex interplay between nucleotide binding and UCP3 activity. Glutathionylation of UCP3 has been observed during oxidative stress conditions, potentially serving as a mechanism to modulate its activity in response to redox status within the mitochondria. S-nitrosylation may similarly provide redox-dependent regulation. Another important consideration is how the lipid environment affects UCP3 function. Specific interactions with cardiolipin, a mitochondrial-specific phospholipid, may be essential for proper folding and activity of UCP3. The presence of specific fatty acids, particularly long-chain unsaturated fatty acids, has been shown to modulate UCP3 activity, potentially through direct binding or by affecting membrane properties .

What analytical approaches best quantify the contribution of UCP3 to mitochondrial bioenergetics?

Quantifying UCP3's contribution to mitochondrial bioenergetics requires a multi-faceted analytical approach that addresses both metabolite transport and potential uncoupling activities. The gold standard for measuring metabolite transport involves reconstituting purified UCP3 into liposomes and performing radioisotope-based transport assays with substrates like [14C]aspartate . This allows determination of transport kinetics (Km and Vmax values) and substrate specificity. For assessing UCP3's impact on mitochondrial coupling efficiency in intact systems, researchers should employ oxygen consumption measurements using high-resolution respirometry. This approach allows calculation of respiratory control ratios and leak respiration in the presence of specific substrates and inhibitors . Comparing these parameters between wild-type, UCP3 knockout, and UCP3-overexpressing systems provides insights into UCP3's bioenergetic impact. Membrane potential measurements using potentiometric dyes like TMRM or JC-1 offer complementary information about proton motive force dissipation . For in vivo quantification, magnetic resonance spectroscopy techniques have proven valuable, allowing simultaneous measurement of ATP synthesis rates (using 31P MRS) and TCA cycle flux (using 13C MRS) as demonstrated in studies with UCP3-overexpressing mice . This approach yielded the important observation that UCP3 overexpression reduced the ATP synthesis/TCA cycle flux ratio by 42%, providing a quantitative measure of decreased mitochondrial efficiency in vivo .

Table 1: Analytical Techniques for Assessing UCP3 Function

TechniqueParameters MeasuredAdvantagesLimitations
Radioisotope transport assaysTransport rates, substrate specificityDirect measurement of transport functionIn vitro system may not reflect in vivo conditions
High-resolution respirometryOxygen consumption, respiratory control ratioApplicable to isolated mitochondria and cellsDifficult to isolate UCP3-specific effects
Membrane potential measurementsProton motive force dissipationSensitive indicator of uncouplingIndirect measure of UCP3 activity
31P MRSATP synthesis ratesNon-invasive in vivo measurementLimited spatial resolution
13C MRSTCA cycle fluxProvides metabolic flux informationRequires specialized equipment and expertise
Combined MRS approachATP synthesis/TCA cycle flux ratioComprehensive in vivo bioenergetic assessmentTechnically challenging and expensive

How can researchers differentiate between UCP3-mediated effects and those of other mitochondrial carriers in experimental systems?

Differentiating UCP3-mediated effects from those of other mitochondrial carriers is essential for accurate interpretation of experimental data. One powerful approach is the use of genetic models with specific UCP3 manipulation. Comparison of UCP3 knockout, wild-type, and UCP3-overexpressing systems allows attribution of observed differences to UCP3 function . For instance, studies with UCP1/UCP3 double knockout mice have revealed that UCP3 is necessary for maximal GDP-sensitive respiration in a UCP1-dependent manner, demonstrating a complementary relationship between these proteins that would not be evident from single knockout models . Pharmacological approaches using specific inhibitors can also help isolate UCP3 effects. While no absolutely specific UCP3 inhibitor exists, differential sensitivity to inhibitors like GDP, pyridoxal-5'-phosphate, and bathophenanthroline can help distinguish UCP3 activity from other carriers . In reconstituted systems, researchers can directly compare transport properties of purified UCP3 with those of other carriers reconstituted under identical conditions, allowing precise characterization of kinetic parameters and substrate specificities . The R282Q mutation specifically abolishes UCP3 transport activity and serves as an excellent negative control in reconstitution experiments . For respiratory measurements in intact mitochondria or cells, substrate-specific respiration protocols can help distinguish between different carrier activities. For example, measuring respiration with specific substrates like aspartate or malate that are preferentially transported by UCP3 can provide insights into its specific contribution to mitochondrial function .

What are the common pitfalls in expressing and handling recombinant UCP3, and how can they be overcome?

Researchers working with recombinant UCP3 frequently encounter several challenges during expression and handling of this hydrophobic membrane protein. One major issue is low expression yield in bacterial systems, which can be addressed by optimizing codon usage for the expression host, using specialized E. coli strains designed for membrane protein expression (such as C0214(DE3)), and carefully controlling induction conditions . Protein aggregation and improper folding represent another significant challenge. UCP3 typically accumulates as inclusion bodies requiring solubilization and refolding steps . To improve folding efficiency, researchers should optimize detergent selection during solubilization, employ step-wise dialysis for refolding, and consider adding specific lipids that stabilize the native conformation. Protein degradation during purification can be minimized by including protease inhibitors throughout the procedure and working at reduced temperatures (4°C). For functional reconstitution into liposomes, inconsistent incorporation efficiency may lead to variable results. This can be addressed by carefully controlling the protein-to-lipid ratio, using freeze-thaw cycles followed by extrusion to ensure uniform proteoliposome formation, and verifying incorporation through biochemical or microscopy techniques . Loss of activity during storage is another common problem, which can be mitigated by adding stabilizing agents (glycerol, specific lipids) and storing the protein at -80°C in single-use aliquots to avoid repeated freeze-thaw cycles. Finally, distinguishing specific UCP3 activity from non-specific effects requires appropriate controls, including empty liposomes and transport-inactive mutants like R282Q .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.