Recombinant Bovine Mitoferrin-1 (SLC25A37)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLC25A37; MFRN; Mitoferrin-1; Mitochondrial iron transporter 1; Solute carrier family 25 member 37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A37
Target Protein Sequence
MELRRGGVGSQARARRMDGDSRDGGGGCKDAGSEDYENLPTSASLSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLNPDPKAHYTSVYGALKKIIRTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNAVFHHQGNSHLANGICKRLSGVRKVSPSTDPSPGFSSL
Uniprot No.

Target Background

Function
Mitoferrin-1 (SLC25A37) is a mitochondrial iron transporter crucial for iron uptake in developing erythroid cells, playing a vital role in heme biosynthesis. The imported iron, likely as Fe(II), is subsequently delivered to ferrochelatase, facilitating its incorporation into protoporphyrin IX to produce heme.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Mitoferrin-1 (SLC25A37) in bovine cells?

Mitoferrin-1 functions as an essential and high-affinity iron importer located on the mitochondrial inner membrane. Its primary role is facilitating the transport of iron into the mitochondria for the biosynthesis of mitochondrial heme and iron-sulfur clusters in vertebrate cells. In bovine systems, as in other vertebrates, it is highly expressed in hematopoietic tissues where it supports erythropoiesis and other iron-dependent mitochondrial processes . Mechanistically, Mitoferrin-1 transports reduced Fe²⁺ from the cytosol into the mitochondrial matrix, where this iron becomes available for incorporation into crucial metabolic enzymes and respiratory chain complexes.

How does Mitoferrin-1 differ from Mitoferrin-2 in terms of function and expression?

While both Mitoferrin-1 and Mitoferrin-2 are mitochondrial iron transporters, they differ significantly in their expression patterns and functional specificity:

CharacteristicMitoferrin-1 (SLC25A37)Mitoferrin-2 (SLC25A28)
Expression patternHighly expressed in fetal and adult hematopoietic tissuesMore broadly expressed across tissues
Role in erythropoiesisEssential for erythroid developmentPlays secondary role in erythropoiesis
Functional redundancyCannot be fully compensated by MFRN2Can partially compensate for MFRN1 loss
Disease associationLoss leads to defective hemoglobinizationLess direct association with anemia

Research from knockout models has shown that MFRN1-deficient cells exhibit severe defects in hemoglobinization and fail to form both primitive and definitive CFU-E colonies, demonstrating its critical role in erythroid maturation . In contrast, studies suggest that Mitoferrin-2 mediates the mitochondrial import of iron required for more general cellular processes and can provide baseline iron transport in non-erythroid tissues .

What experimental systems are most suitable for studying recombinant bovine Mitoferrin-1?

For recombinant bovine Mitoferrin-1 studies, several experimental systems have proven effective:

  • Mammalian expression systems: HEK293 or CHO cells provide appropriate post-translational modifications for functional studies of mitochondrial localization.

  • Yeast complementation assays: S. cerevisiae strains lacking the endogenous mitochondrial iron importers (MRS3/MRS4) can be complemented with bovine MFRN1 to assess functional conservation.

  • ES cell differentiation models: MFRN1-deficient ES cells can be complemented with bovine MFRN1 and differentiated toward erythroid lineages to assess functional rescue during erythropoiesis .

For optimal results, researchers should consider creating stable cell lines rather than transient transfections, as this allows for more consistent expression levels and better assessment of mitochondrial iron homeostasis over time.

How can I optimize expression and purification of functional recombinant bovine Mitoferrin-1 for structural studies?

Optimizing the expression and purification of recombinant bovine Mitoferrin-1 presents significant challenges due to its nature as a mitochondrial membrane protein. A methodological approach includes:

  • Expression system selection: Insect cell systems (Sf9 or Hi5) often yield better results than bacterial systems for mitochondrial membrane proteins. For highest purity, consider using a construct with a cleavable N-terminal tag (His10-TEV) and C-terminal FLAG or Strep tag.

  • Detergent screening: Conduct a systematic screening of detergents for protein extraction and stability using a thermal shift assay. Common starting points include:

    • Mild detergents: DDM (n-Dodecyl-β-D-maltopyranoside) or LMNG (Lauryl maltose neopentyl glycol)

    • Stabilizing additives: Cholesteryl hemisuccinate (CHS) and specific lipids

  • Purification strategy:

    • Employ two-step affinity chromatography (IMAC followed by anti-FLAG)

    • Include a size-exclusion chromatography (SEC) step to ensure monodispersity

    • Maintain detergent concentration above CMC throughout purification

    • Include 5-10% glycerol and 1-5 mM DTT in all buffers

  • Functional verification: Verify mitochondrial iron transport function by reconstituting purified protein into liposomes and conducting iron uptake assays with ⁵⁵Fe or fluorescent iron indicators.

Researchers should note that the hydrophobic nature of Mitoferrin-1's transmembrane domains may necessitate the use of detergent micelles or nanodiscs for structural studies, which can impact protein stability and crystallization properties.

What is the role of Mitoferrin-1 in cancer progression and how might this inform therapeutic approaches?

  • Proliferation enhancement: Overexpression of MFRN1 in glioma cells significantly decreases doubling time (19.7h versus 24.5h in control cells) and enhances colony formation in anchorage-independent cultures (140±8.6 colonies versus 24±3.6 in control cells) .

  • Mitochondrial iron metabolism: MFRN1 overexpression increases mitochondrial iron levels, which enhances ETC complex activity. This metabolic adaptation supports the aggressive tumor phenotype.

  • Metastasis regulation: In a breast cancer mouse model, SLC25A37 (MFRN1) loss reduced liver metastasis but not lung metastasis, suggesting organ-specific iron dependencies .

  • Hypoxia adaptation: MFRN1 expression is induced by HIF1α to support heme synthesis, enabling cancer cells to grow in hypoxic liver regions by utilizing heme to synthesize bilirubin, a lipophilic antioxidant .

  • Ferroptosis resistance: Treating mice with ferroptosis inhibitors fully restored the capacity of MFRN1-deficient cancer cells to grow in the liver, indicating its role in resistance to this form of cell death .

These findings suggest that inhibiting MFRN1-mediated iron transport could be a viable therapeutic strategy for certain cancer types, particularly those with high mitochondrial iron dependency such as glioblastoma and liver metastases.

How can I assess the impact of post-translational modifications on recombinant bovine Mitoferrin-1 activity?

Assessing post-translational modifications (PTMs) of recombinant bovine Mitoferrin-1 requires a multi-faceted analytical approach:

  • Identification of PTM sites:

    • Perform mass spectrometry analysis (LC-MS/MS) on purified protein

    • Use phospho-specific antibodies for phosphorylation detection

    • Employ glycan-specific staining methods for glycosylation detection

  • Site-directed mutagenesis:

    • Generate point mutations at identified or predicted PTM sites

    • Create phosphomimetic (S/T→D/E) or phosphodeficient (S/T→A) mutations

    • Compare activity of wild-type versus mutant proteins

  • Functional assays:

    • Mitochondrial localization: Fluorescent microscopy with organelle-specific markers

    • Iron transport activity: ⁵⁵Fe uptake assays in isolated mitochondria or reconstituted liposomes

    • Protein stability: Pulse-chase experiments with cycloheximide treatment

  • Interaction studies:

    • Co-immunoprecipitation to identify PTM-dependent protein interactions

    • Proximity labeling methods (BioID, APEX) to map the PTM-dependent interactome

For phosphorylation studies specifically, researchers should analyze the protein under different physiological conditions (iron starvation, oxidative stress) to capture dynamic regulation of Mitoferrin-1 activity.

What are the optimal conditions for assessing iron transport activity of recombinant bovine Mitoferrin-1 in vitro?

Assessing iron transport activity of recombinant bovine Mitoferrin-1 requires careful experimental design:

  • Proteoliposome reconstitution:

    • Purified recombinant Mitoferrin-1 should be reconstituted into liposomes at protein:lipid ratios of 1:100 to 1:1000

    • Optimal lipid composition: POPC:POPE:Cardiolipin (70:20:10)

    • Internal buffer: 20 mM HEPES, pH 7.2, 100 mM KCl

  • Transport assay setup:

    • Pre-load proteoliposomes with iron chelator (1 mM ferrozine)

    • Add external Fe²⁺ (10-100 μM) stabilized with ascorbate (1 mM)

    • Monitor iron uptake via absorbance change of the Fe²⁺-ferrozine complex (562 nm)

    • Compare with control liposomes lacking protein

  • Kinetic analysis:

    • Determine initial rates at varying Fe²⁺ concentrations (1-100 μM)

    • Calculate Km and Vmax using Michaelis-Menten kinetics

    • Assess potential inhibitors using IC₅₀ determinations

  • Experimental controls:

    • Ionophore (valinomycin) controls to assess membrane integrity

    • Heat-denatured protein controls

    • Alternative substrate controls to assess specificity

Temperature dependency studies should be performed at 25°C and 37°C to determine optimal conditions and calculate activation energy of transport.

How does iron starvation or overload affect Mitoferrin-1 expression and activity?

Iron starvation and overload conditions significantly impact Mitoferrin-1 regulation through multiple mechanisms:

ConditionEffect on Mitoferrin-1Regulatory MechanismExperimental Assessment Method
Iron starvationIncreased expressionIRE-IRP mediated stabilization of mRNAqRT-PCR, Western blot
Enhanced stabilityReduced proteasomal degradationCycloheximide chase assay
Increased mitochondrial localizationPost-translational regulationSubcellular fractionation
Iron overloadDecreased expressionIRE-IRP mediated degradationqRT-PCR, Western blot
Increased degradationUbiquitin-mediated proteolysisProteasome inhibitors (MG132)
Altered protein interactionsFormation of protein complexesCo-immunoprecipitation

Research has shown that Iron Regulatory Protein-1 (IRP1) protects against Mitoferrin-1-deficient porphyria . This regulation occurs at both transcriptional and post-transcriptional levels. The most reliable method for assessing these changes involves using both iron chelators (deferoxamine, 100 μM) and iron supplementation (ferric ammonium citrate, 100 μg/mL) treatments for 24-48 hours before analyzing Mitoferrin-1 levels and mitochondrial iron content.

What methods can detect the interaction between recombinant bovine Mitoferrin-1 and other iron homeostasis proteins?

Multiple complementary approaches can effectively detect interactions between Mitoferrin-1 and other iron homeostasis proteins:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged recombinant bovine Mitoferrin-1 in appropriate cell lines

    • Perform pulldown with anti-tag antibodies or matrices

    • Identify interacting proteins via LC-MS/MS

    • Validate key interactions with targeted Western blotting

  • Proximity-based labeling:

    • Generate Mitoferrin-1 fusion with BioID2 or APEX2

    • Express in cells and activate labeling (biotin addition or H₂O₂ pulse)

    • Purify biotinylated proteins and identify via MS

    • This method captures transient and weak interactions in native context

  • Förster Resonance Energy Transfer (FRET):

    • Create Mitoferrin-1-CFP and potential partner-YFP fusions

    • Express in living cells and measure FRET efficiency

    • Verify subcellular localization with mitochondrial markers

    • Particularly useful for dynamic interaction studies

  • Split-luciferase complementation assays:

    • Fuse Mitoferrin-1 and potential partners to complementary luciferase fragments

    • Measure luminescence upon protein interaction

    • Conduct in live cells for real-time interaction monitoring

Researchers should focus on known iron homeostasis proteins including frataxin, ABCB10, ferrochelatase, and IRP1/IRP2 as potential interaction partners, as these have been implicated in mitochondrial iron processing pathways that would logically involve Mitoferrin-1 .

What are the common pitfalls when working with recombinant membrane proteins like Mitoferrin-1?

Working with recombinant Mitoferrin-1 presents several challenges that researchers should anticipate:

  • Expression difficulties:

    • Low expression yields due to toxicity

    • Protein misfolding and aggregation

    • Improper membrane insertion

    Solution: Optimize codon usage for bovine sequences, use inducible expression systems, and consider fusion partners like GFP to monitor expression and folding.

  • Purification challenges:

    • Detergent-induced destabilization

    • Co-purification of endogenous lipids

    • Loss of function during purification

    Solution: Screen multiple detergents systematically, maintain strict temperature control (4°C), and include stabilizing additives like glycerol and reducing agents.

  • Functional assessment issues:

    • Background iron transport in control samples

    • Iron oxidation during transport assays

    • Non-specific binding of iron to membranes

    Solution: Include oxygen scavengers in transport buffers, carefully prepare iron solutions immediately before use, and conduct thorough controls with inactive protein mutants.

  • Variability between preparations:

    • Inconsistent lipid composition

    • Batch-to-batch protein purity differences

    • Variable post-translational modifications

    Solution: Establish rigorous quality control metrics, standardize purification protocols with detailed documentation, and analyze each preparation by multiple methods (SEC, SDS-PAGE, Western blot).

How can I differentiate between direct and indirect effects when studying Mitoferrin-1 function in cellular models?

Differentiating between direct and indirect effects of Mitoferrin-1 manipulation requires careful experimental design:

  • Acute versus chronic manipulation:

    • Use inducible expression/knockdown systems (Tet-On/Off)

    • Compare immediate effects (0-6 hours) versus long-term adaptation (>48 hours)

    • Monitor time-course of changes in iron-dependent processes

  • Rescue experiments:

    • Complement MFRN1 knockout cells with wild-type or mutant versions

    • Use structure-based mutations that specifically affect iron transport

    • Include related transporters (MFRN2) to test functional specificity

  • Metabolite supplementation:

    • Bypass mitochondrial iron import by supplementing with downstream products

    • Add hemin to bypass heme synthesis defects

    • Provide iron-sulfur cluster-containing enzymes or their products

  • Multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics

    • Establish temporal relationships between changes

    • Use network analysis to identify direct versus secondary effects

Studies examining the effects of Mitoferrin-1 overexpression on glioma cell proliferation demonstrated that increased MFRN1 levels led to enhanced mitochondrial iron, increased ETC complex activity, and ultimately greater cell proliferation . To establish this causal pathway, researchers conducted careful metabolic rescue experiments with antioxidants and iron chelators.

What strategies can address the tissue-specific roles of Mitoferrin-1 in disease models?

Addressing tissue-specific roles of Mitoferrin-1 requires sophisticated experimental approaches:

  • Conditional knockout models:

    • Generate tissue-specific Cre-loxP MFRN1 knockout animals

    • Use inducible promoters (e.g., tamoxifen-inducible) for temporal control

    • Compare phenotypes across multiple tissues

  • Organ-on-chip technology:

    • Develop multi-cellular tissue models incorporating cell-specific MFRN1 manipulation

    • Model tissue microenvironments with appropriate oxygen gradients

    • Assess cell-cell interactions in heterogeneous populations

  • Tissue-specific promoters for expression:

    • Use liver-specific (albumin), hematopoietic (vav), or other tissue-specific promoters

    • Create reporter constructs to monitor tissue-specific expression

    • Compare expression patterns with disease progression

  • Metastasis models:

    • Employ orthotopic injection models targeting specific organs

    • Compare organ-specific metastatic potential as demonstrated in breast cancer models

    • Analyze differential gene expression between metastases at different sites

Research has demonstrated that SLC25A37 (MFRN1) functions as an organ-specific determinant of metastatic colonization, with its loss reducing liver but not lung metastasis in breast cancer models . This organ-specificity relates to the different metabolic requirements of cancer cells in these environments, with liver metastases particularly dependent on heme-mediated protection against ferroptosis.

How might CRISPR/Cas9 genome editing advance our understanding of Mitoferrin-1 function?

CRISPR/Cas9 technology offers powerful approaches to investigate Mitoferrin-1 biology:

  • Endogenous tagging:

    • Insert fluorescent proteins or affinity tags at the native locus

    • Preserve natural regulation while enabling visualization or purification

    • Create knock-in cell lines expressing Mitoferrin-1-GFP fusion proteins

  • Domain mapping:

    • Generate precise deletions or substitutions of functional domains

    • Target conserved residues identified through evolutionary analysis

    • Create series of minimal functional variants

  • Promoter engineering:

    • Modify endogenous promoter elements to alter expression

    • Create reporter knock-ins to monitor transcriptional regulation

    • Engineer iron-responsive elements to manipulate regulation

  • High-throughput screening:

    • Conduct genome-wide CRISPR screens for synthetic lethality with MFRN1 deficiency

    • Identify compensatory pathways that become essential in MFRN1-deficient cells

    • Discover novel genes involved in mitochondrial iron homeostasis

In vivo CRISPR screens have already identified SLC25A37 as an organ-specific determinant of metastatic colonization, demonstrating the power of this approach . Future applications could include pooled CRISPR screens in primary bovine cells to identify species-specific regulatory mechanisms.

What potential therapeutic applications might target Mitoferrin-1 in disease contexts?

Research suggests several promising therapeutic applications targeting Mitoferrin-1:

Disease ContextTherapeutic ApproachMechanismDevelopment Status
GlioblastomaMFRN1 inhibitorsReduce mitochondrial iron, suppress proliferationPreclinical
Liver metastasisIron chelation therapyBlock MFRN1-dependent heme synthesisPreclinical
Erythroid disordersMFRN1 activatorsEnhance iron availability for heme synthesisConceptual
Ferroptosis-sensitive cancersCombined MFRN1/GPX4 inhibitionPromote ferroptotic cell deathEarly research
Iron overload disordersMitochondria-targeted chelatorsReduce mitochondrial iron accumulationConceptual

Studies have demonstrated that MFRN1 overexpression in glioma cells significantly increases mitochondrial iron levels, enhances proliferation rates, and significantly decreases survival in orthotopic mouse models . Targeting MFRN1 could therefore represent a novel approach for treating aggressive cancers like GBM. Additionally, research showing that SLC25A37 loss inhibited liver metastasis suggests that MFRN1 inhibition could complement existing therapies for metastatic disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.