Recombinant Bovine Motile sperm domain-containing protein 1 (MOSPD1)

Shipped with Ice Packs
In Stock

Description

Functions and Mechanisms of MOSPD1

MOSPD1 is known to be involved in the regulation of transcription by RNA polymerase II, with roles in both negative and positive regulation . In the context of colorectal cancer, MOSPD1 is upregulated by the Wnt/β-catenin signaling pathway, which plays a crucial role in cancer development and progression . This upregulation is mediated through enhancer elements in the 3'-flanking region of the MOSPD1 gene, interacting with transcription factors like TCF7L2 and β-catenin .

Colorectal Cancer

  • Expression Levels: MOSPD1 expression is significantly higher in colorectal cancer tissues compared to non-tumor tissues, with a 2.18-fold increase .

  • Correlation with Wnt Targets: MOSPD1 expression correlates positively with known Wnt target genes such as RNF43, AXIN2, and MYC .

  • Mechanism: The Wnt/β-catenin pathway regulates MOSPD1 through specific enhancer elements in its 3'-flanking region .

Mesenchymal Stem Cells

  • Proliferation and Differentiation: Cells deficient in MOSPD1 show defects in mesenchymal stem cell proliferation and differentiation, indicating a role for MOSPD1 in these processes .

Early Embryos

  • Marker for Development: MOSPD1 is identified as a putative marker for early-stage human embryos, specifically at the 3-day, 8-cell stage .

Potential Applications and Future Directions

While specific studies on "Recombinant Bovine Motile sperm domain-containing protein 1 (MOSPD1)" are not available, understanding its human counterpart provides a foundation for exploring its potential applications in biotechnology and veterinary medicine. Recombinant proteins are often used for research, diagnostics, and therapeutic purposes, and MOSPD1 could potentially be used in similar contexts if its bovine form is developed and studied.

Data Tables

Given the lack of specific data on "Recombinant Bovine Motile sperm domain-containing protein 1 (MOSPD1)", we can summarize some key findings related to human MOSPD1:

ContextKey Findings
Colorectal CancerElevated expression in tumor tissues; regulated by Wnt/β-catenin pathway .
Mesenchymal Stem CellsEssential for proliferation and differentiation .
Early EmbryosPotential marker for early development stages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOSPD1; Motile sperm domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MOSPD1
Target Protein Sequence
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY VVVDAAGAVKPQCCMDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPS AKEQQKEEEEKRIKEHLTESLFFEQSFQPENRTVSSGPSLLTVFLAVVCITALMLPTLGD VESLVPLYLHLSVNQKLVAAYILGLITMAIFRT
Uniprot No.

Target Background

Function

Recombinant Bovine Motile sperm domain-containing protein 1 (MOSPD1) plays a role in mesenchymal stem cell differentiation and/or proliferation. It has been proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, further research suggests that its role in EMT or stem cell self-renewal may be limited to later stages of differentiation, rather than being essential for these processes.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.