Recombinant Bovine Motile sperm domain-containing protein 3 (MOSPD3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOSPD3; Motile sperm domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MOSPD3
Target Protein Sequence
MRRGAPQDQELVGPGAPGRGSRGAPPPSGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP
TGAVLRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPHPRNYDVQDRFRIELSEEG
TEGRVVGRKDITSVLRAPAYPLELQGQSDPTPHPEPHSWTASSTAQPFPENPHPQLATSS
FLLFLLMGTVSVAFLLLPLQDELGSQLPQILHVSLGQKLVAAYVLGLLTMVFLRT
Uniprot No.
Target Background
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
