Recombinant Bovine Mpv17-like protein 2 (MPV17L2)

Shipped with Ice Packs
In Stock

Description

Overview and Definition

Recombinant Bovine MPV17L2 refers to a truncated form of the mitochondrial protein MPV17L2 (MPV17 mitochondrial membrane protein-like 2), expressed in mammalian cell systems. This recombinant protein is engineered for research purposes, enabling functional studies of its role in mitochondrial biology. MPV17L2 is a 206-amino-acid transmembrane protein localized to the inner mitochondrial membrane (IMM), where it interacts with mitochondrial ribosomal components and nucleic acids .

Research Findings and Functional Insights

MPV17L2 is critical for mitochondrial ribosome assembly and mtDNA organization. Key findings include:

Ribosomal Biogenesis

FunctionMechanismImpact
mtLSU and Monosome BindingAssociates with the large mitochondrial ribosomal subunit (mtLSU) and monosome .Required for ribosome subunit unification.
Ribosomal Protein StabilityEnsures proper assembly/stability of mtSSU and mtLSU components (e.g., MRPL3, MRPS18B) .Depletion causes ribosomal subunit dissociation.
Nucleoid InteractionCo-localizes with mtDNA-rich nucleoids and mitochondrial nucleic acids .Disruption leads to mtDNA aggregation .

Mitochondrial DNA Dynamics

  • mtDNA Aggregation: MPV17L2 depletion induces nucleoid enlargement and mtDNA clustering, independent of mtDNA depletion .

  • mtRNA Stability: Reduced MPV17L2 expression impairs mitochondrial translation, as evidenced by diminished monosome levels and impaired protein synthesis .

Pathway Involvement and Biological Relevance

MPV17L2 is linked to the Peroxisome pathway, though its primary role is mitochondrial. Related pathway components include:

PathwayAssociated Proteins
PeroxisomePRDX5, HAO1, NOS2B, PEX2, PEX19, SCP2, PEX1, CAT, HAO2, FAR2

MPV17L2’s inclusion in this pathway may reflect indirect regulatory interactions, though its core function resides in mitochondrial ribosome assembly .

Applications and Research Implications

  1. Mitochondrial Disease Modeling: MPV17L2 knockdown mimics ribosomal defects seen in mitochondrial disorders, enabling studies of ribosome-nucleoid interactions .

  2. Therapeutic Targeting: Insights into MPV17L2’s role in translation may inform strategies for mtDNA depletion syndromes, though direct therapeutic applications remain speculative.

  3. Structural Studies: The recombinant protein facilitates biochemical assays (e.g., co-sedimentation, immunoprecipitation) to map ribosomal interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MPV17L2; Mpv17-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
MPV17L2
Target Protein Sequence
MPPGGWRWLRGLWAAGQPLFQGRALLVTNTLGCGVLMAAGDGARQTWEIRARPGQKFDPR RSVSMFAVGCSMGPFLHYWYLWLDRLFPASGFPGLPNVLKKVLIDQLVASPMLGVWYFLG LGCLEGQTLDKSCQELRDKFWEFYKADWCVWPAAQLVNFLFVPPQFRVTYINGLTLGWDT YLSYLKYRIPGPLTPPGCVALGTIQTEPPDARQQGKTD
Uniprot No.

Target Background

Function
Essential for the assembly and stability of the mitochondrial ribosome; acts as a positive regulator of mitochondrial protein synthesis.
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion inner membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.