Recombinant Bovine Muscarinic acetylcholine receptor M2 (CHRM2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM2; Muscarinic acetylcholine receptor M2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNNSTNSSNNVALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYF LFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDR YFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFF SNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIV KPNNNNMPGSDDGLEHNKIQNGKTPRDAVTENCVQGEEKESSNDSTSVSAVASNMRDDEI TQDENTVSTSVGHSKDENSKQTCIKIVTKTPKGDQCTPTNTTVELVGSSGQNGDEKQNIV ARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTV WTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor (M2) mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is adenylate cyclase inhibition. Signaling promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3); this then triggers calcium ion release into the cytosol.
Gene References Into Functions
  1. The initial discovery involved the identification and purification of a vinpocetine and muscarinic antagonist-inhibited and CaM-activated plasma membrane-bound PDE1A, linked to M(2)AChR. PMID: 26513204
  2. Airway M(2)Rs inhibit BK channels via a dual, Gbetagamma-mediated mechanism, including a direct membrane-delimited interaction, and the activation of the phospholipase C/protein kinase C pathway. PMID: 18524769
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the muscarinic acetylcholine receptor M2?

The muscarinic acetylcholine receptor M2 (CHRM2) is a G protein-coupled receptor (GPCR) with a multi-pass transmembrane structure that mediates various cellular responses. It functions primarily through inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G protein actions. The receptor promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3), which triggers calcium ion release into the cytosol . CHRM2 is located in the cell membrane and postsynaptic cell membrane, and undergoes phosphorylation in response to agonist binding, which promotes receptor internalization . As a prototypical GPCR, M2R serves as an important model system for understanding receptor regulation by both orthosteric and allosteric ligands .

How does CHRM2 signaling differ from other muscarinic receptor subtypes?

CHRM2 signaling is distinct from other muscarinic receptor subtypes primarily in its signal transduction pathway. While some muscarinic receptors primarily couple to Gq proteins to activate phospholipase C, CHRM2 predominantly couples to Gi/o proteins, resulting in inhibition of adenylate cyclase as its primary transducing effect . This inhibitory action distinguishes it from excitatory muscarinic receptors. Additionally, CHRM2 has distinctive roles in the regulation of acetylcholine release and dopamine signaling . The receptor also has unique functional implications in learning, memory, attention, and motor control processes .

What are the key structural regions of CHRM2 that determine its functional properties?

The key structural regions of CHRM2 include its orthosteric binding site (where endogenous ligands like acetylcholine bind), allosteric binding sites (topographically distinct from the orthosteric site), and intracellular domains that interact with G-proteins and other signaling molecules. Cryo-electron microscopy (cryo-EM) studies have revealed that CHRM2 exhibits conformational heterogeneity when bound to different ligands, with distinct G-protein orientations observed depending on the bound agonist . The intracellular regions of the receptor are particularly important for determining signaling specificity, as they mediate interactions with G-proteins and β-arrestins. These structural features collectively contribute to the receptor's ability to mediate various cellular responses through different signaling pathways .

What are the most effective methods for expressing recombinant bovine CHRM2 for structural studies?

For structural studies of recombinant CHRM2, researchers typically employ expression systems that can produce sufficient quantities of properly folded protein. Based on approaches used for similar GPCRs, effective methods include:

  • Insect cell expression systems: Sf9 or High Five insect cells are commonly used for GPCR expression, as they facilitate proper protein folding and post-translational modifications.

  • Stabilizing modifications: Introduction of specific mutations or fusion partners (like T4 lysozyme or BRIL) can enhance stability for structural studies. These approaches have been successfully employed in cryo-EM studies of M2R .

  • Codon optimization: Adapting the coding sequence to the expression host's codon usage can significantly improve protein yields.

  • Inducible expression systems: Using inducible promoters allows controlled expression timing, which can enhance proper folding and reduce toxicity.

The purification typically involves solubilization with appropriate detergents or reconstitution into nanodiscs or other membrane mimetics to maintain the native conformation for structural studies .

What expression tags and purification strategies optimize yield and activity of recombinant CHRM2?

Optimizing expression tags and purification strategies is crucial for obtaining high-quality recombinant CHRM2:

  • Affinity tags: Polyhistidine (His) tags are commonly used for initial purification using immobilized metal affinity chromatography (IMAC). FLAG, Strep, or HA tags may also be employed depending on the experimental requirements.

  • Fusion partners: Fusion proteins like maltose-binding protein (MBP) or glutathione S-transferase (GST) can enhance solubility and expression levels.

  • Cleavable linkers: Including TEV or PreScission protease recognition sites allows removal of tags after purification.

  • Detergent selection: For membrane proteins like CHRM2, the choice of detergent is critical. Mild detergents such as DDM, LMNG, or GDN are often used to maintain receptor functionality.

  • Stabilizing ligands: Including high-affinity ligands during purification can stabilize the receptor in specific conformations.

  • Chromatography steps: Sequential purification using multiple chromatography techniques (affinity, ion exchange, size exclusion) yields highly pure protein preparations suitable for structural and functional studies .

How can I verify the proper folding and functionality of purified recombinant CHRM2?

To verify proper folding and functionality of purified recombinant CHRM2, several complementary approaches can be used:

  • Ligand binding assays: Radioligand binding assays using well-characterized CHRM2 ligands like [³H]QNB (shown in database entry SynPHARM 1190) can confirm binding functionality and determine Kd values.

  • Thermal stability assays: Techniques such as differential scanning fluorimetry (DSF) or thermal shift assays can assess protein stability and proper folding.

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure composition to verify proper folding.

  • Size exclusion chromatography: Monodisperse elution profiles indicate homogeneous and well-folded protein preparations.

  • Functional assays: G-protein coupling assays, GTPγS binding assays, or cell-based signaling assays can verify functional activity.

  • Cryo-EM or structural studies: Obtaining high-resolution structural data provides the ultimate verification of proper folding .

What are the most reliable antibodies and detection methods for CHRM2 in different experimental contexts?

For reliable detection of CHRM2 across different experimental approaches, researchers should consider:

  • Validated antibodies: Monoclonal antibodies like the one described in the Abcepta catalog (clone 1424CT461.78.60) have been validated for multiple applications including western blotting (WB), immunohistochemistry (IHC-P), immunofluorescence (IF), and flow cytometry (FC) .

  • Application-specific dilutions: Optimal antibody dilutions vary by application:

    • Western blotting: 1:500

    • Immunohistochemistry: 1:25

    • Immunofluorescence: 1:25

    • Flow cytometry: 1:25

  • Cross-reactivity considerations: When working with bovine CHRM2, verify cross-reactivity of antibodies, as many are developed against human or mouse targets. The antibody from Abcepta shows reactivity with human and mouse CHRM2 .

  • Storage conditions: Maintain antibodies refrigerated at 2-8°C for short-term storage (up to 2 weeks) or at -20°C in small aliquots for long-term storage to prevent freeze-thaw cycles .

  • Positive controls: Use recombinant CHRM2 protein or known expressing tissues as positive controls to validate detection methods.

What are the optimal conditions for studying CHRM2-ligand interactions using biophysical methods?

Optimal conditions for studying CHRM2-ligand interactions using biophysical methods include:

  • Buffer composition: Typically, a physiological buffer system (pH 7.4) containing stabilizing agents like cholesterol hemisuccinate (CHS) and appropriate detergents is used to maintain receptor stability.

  • Temperature control: Most binding assays are performed at either room temperature (20-25°C) or 37°C to reflect physiological conditions.

  • Surface plasmon resonance (SPR): For studying binding kinetics, immobilize purified CHRM2 on sensor chips with controlled orientation to expose binding sites.

  • Isothermal titration calorimetry (ITC): Use high protein concentrations (typically 10-50 μM) in detergent-solubilized or nanodisc-reconstituted preparations.

  • Fluorescence-based assays: Techniques like fluorescence polarization or FRET can detect binding events using fluorescently labeled ligands or receptor constructs.

  • Microscale thermophoresis (MST): This newer technique requires minimal sample amounts and can determine binding affinities in near-native conditions.

  • Cryo-EM studies: For structural analysis of ligand binding, prepare samples with saturation concentrations of ligands as demonstrated in studies of CHRM2 with acetylcholine and iperoxo .

How can I design effective functional assays to measure CHRM2 signaling pathways?

Designing effective functional assays to measure CHRM2 signaling pathways requires consideration of multiple aspects:

  • G-protein-dependent assays:

    • cAMP inhibition assays: Since CHRM2 primarily inhibits adenylate cyclase, measuring decreases in forskolin-stimulated cAMP production using ELISA or BRET-based sensors is effective.

    • GTPγS binding assays: Measure nucleotide exchange on G proteins upon receptor activation.

    • BRET/FRET-based sensors: Use these to monitor real-time G-protein coupling.

  • Downstream signaling assays:

    • Calcium flux: Although not the primary pathway, CHRM2 can indirectly influence calcium signaling, which can be measured using fluorescent calcium indicators.

    • Potassium channel modulation: Electrophysiological techniques can measure CHRM2-mediated modulation of potassium channels.

  • β-arrestin recruitment:

    • BRET/FRET assays: Measure recruitment of fluorescently tagged β-arrestin to the receptor.

    • Conformational biosensors: Use intramolecular sensors to detect conformational changes.

  • Biased signaling assessment:

    • Design assays that can simultaneously or separately measure G-protein and β-arrestin pathways to detect biased signaling of different ligands .

  • Controls:

    • Include well-characterized agonists (acetylcholine, iperoxo) and antagonists.

    • Use positive allosteric modulators like LY2119620 to study allosteric modulation .

What are the key orthosteric and allosteric ligands for studying CHRM2 function?

Key ligands for studying CHRM2 function include:

Orthosteric Ligands:

  • Acetylcholine: The endogenous physiological agonist .

  • Iperoxo: A supra-physiological agonist with higher potency than acetylcholine .

  • QNB ([³H]QNB): A radiolabeled antagonist commonly used in binding studies .

  • McN-A-343: A partial agonist studied in rat heart preparations .

Allosteric Ligands:

  • LY2119620: A positive allosteric modulator (PAM) that increases affinity for both acetylcholine and iperoxo but differentially modulates their efficacy in G-protein and β-arrestin pathways .

The selection of these ligands should be based on the specific research questions, with considerations for:

  • Differential effects on various signaling pathways

  • Species-specific potency variations

  • Experimental context (in vitro vs. in vivo)

  • Required selectivity against other muscarinic receptor subtypes

How do orthosteric and allosteric modulators differently affect CHRM2 conformational dynamics?

Orthosteric and allosteric modulators induce distinct effects on CHRM2 conformational dynamics:

Orthosteric Agonists:

  • Acetylcholine stabilizes a more heterogeneous M2R-G-protein complex compared to iperoxo, with two conformers showing distinctive G-protein orientations .

  • Different orthosteric agonists can induce varying degrees of conformational changes, leading to different efficacy profiles in downstream signaling pathways.

Allosteric Modulators:

  • The positive allosteric modulator LY2119620 increases the binding affinity for both acetylcholine and iperoxo .

  • LY2119620 differentially modulates agonist efficacy in G-protein and β-arrestin pathways .

  • Structural and spectroscopic analyses suggest that LY211620 stabilizes distinct intracellular conformational ensembles compared to agonist-bound M2R .

  • These distinct conformational ensembles may enhance β-arrestin recruitment while impairing G-protein activation .

These findings highlight that conformational dynamics play a crucial role in determining the complex signaling behavior of CHRM2, with different ligands stabilizing distinct receptor conformations that preferentially couple to different downstream effectors .

What methodological approaches can detect biased signaling at CHRM2?

Detecting biased signaling at CHRM2 requires methodological approaches that can quantitatively measure multiple signaling pathways:

  • Parallel pathway assays:

    • Measure G-protein activation (GTPγS binding, cAMP inhibition) and β-arrestin recruitment (BRET/FRET assays) in parallel under identical conditions.

    • Compare concentration-response curves and calculate bias factors using mathematical models like operational models of receptor agonism.

  • BRET-based biosensors:

    • Implement multiplexed BRET assays that can simultaneously monitor G-protein activation and β-arrestin recruitment.

    • Use conformational biosensors that detect distinct active conformations of the receptor.

  • Phosphorylation pattern analysis:

    • Different phosphorylation patterns can indicate biased signaling; use phospho-specific antibodies or mass spectrometry to detect these patterns.

  • Kinetic measurements:

    • Measuring the kinetics of different pathway activations can reveal temporal biases in signaling.

  • Structural approaches:

    • Cryo-EM studies with different ligands, as demonstrated with acetylcholine, iperoxo, and LY2119620, can reveal structural conformations associated with biased signaling .

    • NMR spectroscopy can detect subtle conformational changes associated with different signaling outcomes.

  • Positive controls:

    • Include known biased ligands as references. For example, the study showed that LY2119620 differentially modulates efficacy in G-protein and β-arrestin pathways .

What are the key genetic variants of CHRM2 and their functional implications?

Several genetic variants of CHRM2 have been identified with significant functional implications:

  • rs1455858: This polymorphism has been associated with substance use behaviors and disinhibition in high-risk adolescents. Studies have shown significant associations between this variant and measures of substance use (alcohol, tobacco, and marijuana) as well as temperamental indicators of behavioral disinhibition .

  • Chromosome 7q locus: Linkage analyses have identified a susceptibility locus for alcohol dependence on chromosome 7q that contains CHRM2 .

  • Intron 3-4 variants: The strongest associations with externalizing behaviors were localized in a linkage disequilibrium (LD) block on intron 3-4 of the CHRM2 gene .

The functional implications of these variants include:

  • Altered risk for substance use disorders

  • Differences in behavioral inhibition traits

  • Potential effects on cognitive abilities

  • Possible influences on electrophysiological endophenotypes like P300 event-related potential

Research has suggested that associations of CHRM2 variants with cognitive or behavioral phenotypes may be more readily detected in samples with elevated risk for substance use or externalizing behaviors .

How do species differences in CHRM2 affect experimental design and data interpretation?

Species differences in CHRM2 necessitate careful consideration in experimental design and data interpretation:

  • Sequence homology: While CHRM2 is highly conserved across species, subtle amino acid differences exist between human, bovine, rodent, and other mammalian species. These differences can affect:

    • Ligand binding affinities

    • G-protein coupling efficiency

    • Phosphorylation patterns

    • Response to allosteric modulators

  • Expression patterns: Tissue distribution and expression levels of CHRM2 vary between species, affecting the relevance of specific experimental models.

  • Pharmacological profiles: Drug responses can differ significantly between species:

    • The binding data for McN-A-343 is specifically noted to be from rat heart preparations, highlighting species-specific pharmacology .

    • Cross-species validation is essential when developing new compounds.

  • Antibody selection: When selecting antibodies, verify cross-reactivity with the species of interest:

    • The antibody described in the search results shows reactivity with human and mouse CHRM2, but bovine reactivity would need to be verified .

  • Translation considerations: When extrapolating findings across species:

    • Validate key findings across multiple species when possible

    • Consider the evolutionary conservation of specific functional domains

    • Be cautious when interpreting behavioral phenotypes across species

What is known about CHRM2 interactions with other proteins in signaling complexes?

CHRM2 interacts with various proteins to form functional signaling complexes:

  • G-protein interactions:

    • CHRM2 primarily couples to inhibitory Gi/o proteins, leading to inhibition of adenylate cyclase .

    • Cryo-EM studies have revealed distinct conformations of M2R-G-protein complexes with different orientations of the G-protein depending on the bound agonist .

  • β-arrestin recruitment:

    • Following agonist binding, CHRM2 undergoes phosphorylation, which promotes receptor internalization .

    • This phosphorylation facilitates β-arrestin recruitment, which can both terminate G-protein signaling and initiate arrestin-dependent signaling pathways.

    • Different phosphorylation patterns can lead to different functional outcomes.

  • Modulation of ion channels:

    • CHRM2 modulates potassium channels through direct G-protein interactions .

    • These interactions are critical for the regulation of cardiac function.

  • Presynaptic interactions:

    • CHRM2 regulates acetylcholine release through interactions with presynaptic machinery.

    • It also modulates dopamine signaling through protein-protein interactions .

  • Signaling complex dynamics:

    • The conformational heterogeneity observed in CHRM2 complexes suggests that different ligands can stabilize distinct signaling complexes .

    • The positive allosteric modulator LY2119620 stabilizes distinct intracellular conformational ensembles that may preferentially interact with different signaling partners .

How can CHRM2 be studied in the context of neurodegenerative diseases?

Studying CHRM2 in the context of neurodegenerative diseases involves several specialized approaches:

  • Disease model systems:

    • Develop transgenic models with disease-relevant CHRM2 mutations

    • Use induced pluripotent stem cells (iPSCs) derived from patients with neurodegenerative conditions to study CHRM2 function in disease-relevant cell types

    • Implement organoid models that recapitulate brain region-specific CHRM2 signaling

  • Cholinergic system analysis:

    • Examine alterations in CHRM2 expression, localization, and function in neurodegenerative conditions

    • Study the relationship between CHRM2 and cholinergic deficits in conditions like Alzheimer's disease

    • Investigate interactions between CHRM2 and disease-associated proteins (e.g., amyloid-β, tau)

  • Synaptic plasticity assessment:

    • Given CHRM2's role in synaptic plasticity, learning, memory, attention, and motor control , examine how disease states affect these functions

    • Use electrophysiological techniques to measure CHRM2-dependent changes in synaptic strength

  • Therapeutic targeting strategies:

    • Develop allosteric modulators that can fine-tune CHRM2 function in disease states

    • Explore biased ligands that can activate beneficial signaling pathways while minimizing unwanted effects

    • Study combination approaches that target CHRM2 alongside other disease-relevant targets

  • Neuroinflammatory connections:

    • Investigate the role of CHRM2 in modulating neuroinflammatory processes that contribute to neurodegenerative diseases

What are the current challenges in developing subtype-selective compounds for CHRM2?

Developing subtype-selective compounds for CHRM2 faces several significant challenges:

What methodological approaches can be used to study CHRM2 in native tissue contexts?

Studying CHRM2 in native tissue contexts requires specialized methodological approaches:

  • Tissue-specific expression analysis:

    • RNAscope or single-cell RNA sequencing to precisely map CHRM2 expression patterns

    • Immunohistochemistry with validated antibodies (using recommended dilutions like 1:25 for IHC-P)

    • In situ proximity ligation assays to detect CHRM2 interactions with other proteins in tissue sections

  • Functional studies in native tissues:

    • Ex vivo tissue preparations (e.g., cardiac tissue slices, brain slices)

    • Electrophysiological recordings in native tissues expressing CHRM2

    • Calcium imaging in tissue slices to monitor signaling dynamics

    • FRET/BRET biosensors expressed in specific cell types through genetic approaches

  • In vivo approaches:

    • Cell type-specific genetic manipulation of CHRM2 using Cre-Lox systems

    • Chemogenetic approaches (e.g., DREADD technology) to selectively manipulate CHRM2-expressing cells

    • In vivo microdialysis to measure neurotransmitter changes in response to CHRM2 modulation

    • Fiber photometry or miniscope imaging to monitor CHRM2-dependent signaling in awake, behaving animals

  • Native receptor isolation:

    • Native tissue co-immunoprecipitation to identify interacting partners

    • Proximity labeling approaches (BioID, APEX) to identify the CHRM2 interactome in native contexts

    • Mass spectrometry to identify post-translational modifications in native CHRM2

  • Pharmacological approaches:

    • Use of subtype-selective compounds when available

    • Combination approaches with genetic manipulations

How should researchers account for CHRM2 conformational heterogeneity in structural studies?

Accounting for CHRM2 conformational heterogeneity in structural studies requires specialized approaches:

  • Cryo-EM classification analysis:

    • Implement advanced 3D classification approaches to separate distinct conformational states

    • As demonstrated in recent studies, acetylcholine stabilizes a more heterogeneous M2R-G-protein complex than iperoxo, with two distinguishable conformers showing different G-protein orientations

    • Use larger datasets to capture rare conformational states

  • Integrative structural approaches:

    • Combine multiple structural methods (cryo-EM, X-ray crystallography, NMR, molecular dynamics)

    • Each method provides complementary information about receptor dynamics

  • Time-resolved structural methods:

    • Implement time-resolved cryo-EM or X-ray free-electron laser (XFEL) studies to capture conformational transitions

    • These approaches can reveal intermediates between major conformational states

  • Molecular dynamics simulations:

    • Use enhanced sampling techniques to model conformational transitions

    • Validate computational models against experimental structural data

    • Predict conformational ensembles stabilized by different ligands

  • Analysis and reporting standards:

    • Clearly report the distribution of particles across different conformational classes

    • Validate structural models using independent experimental approaches

    • Provide measures of local resolution for different regions of the structure

    • Deposit all identified conformational states in structural databases

What statistical approaches are most appropriate for analyzing CHRM2 genetic association studies?

For analyzing CHRM2 genetic association studies, several statistical approaches are particularly appropriate:

  • Candidate SNP analysis:

    • When examining specific SNPs like rs1455858, use appropriate genetic models (additive, dominant, recessive)

    • The study referenced coded rs1455858 as a three-level ordinal variable (0 = CC; 1 = CT; 2 = TT) based on initial descriptive analyses

  • Multiple testing correction:

    • Apply appropriate corrections for multiple comparisons (Bonferroni, false discovery rate)

    • Consider the linkage disequilibrium structure when determining the effective number of independent tests

  • Structural equation modeling (SEM):

    • Particularly useful for examining mediation effects

    • The referenced study used SEM to demonstrate that temperamental disinhibition mediated the association between CHRM2 variation and substance use

    • SEM can model complex relationships between genetic variants, intermediate phenotypes, and outcomes

  • Latent variable approaches:

    • Useful for creating composite measures of related phenotypes

    • The study used latent variable modeling to create composite measures of substance use and disinhibition

  • Sample size and power considerations:

    • Calculate required sample sizes based on expected effect sizes

    • Consider using high-risk samples where variability in relevant phenotypes is greater

  • Meta-analysis approaches:

    • Combine data across multiple studies to increase power

    • Account for between-study heterogeneity using random-effects models

  • Hardy-Weinberg equilibrium testing:

    • Always verify that genotype frequencies do not diverge from Hardy-Weinberg equilibrium

    • In the referenced study, genotype frequencies for rs1455858 did not diverge from Hardy-Weinberg equilibrium (χ²(2) = 1.47, ns)

How can researchers integrate data from different experimental approaches to build comprehensive models of CHRM2 function?

Integrating data from diverse experimental approaches to build comprehensive models of CHRM2 function requires systematic methodologies:

  • Multi-scale modeling approaches:

    • Integrate structural data (cryo-EM, X-ray crystallography) with functional assays

    • Develop computational models that connect atomic-level structural changes to cellular signaling outcomes

    • Use machine learning approaches to identify patterns across diverse datasets

  • Systems biology frameworks:

    • Develop mathematical models of CHRM2 signaling networks

    • Incorporate data from multiple experimental modalities (structural, genetic, pharmacological)

    • Use ordinary differential equation (ODE) models to capture signaling dynamics

    • Implement Bayesian approaches to update models as new data becomes available

  • Cross-species data integration:

    • Compare data across species to identify conserved mechanisms

    • Account for species differences when translating findings

    • Use evolutionary conservation as a filter for identifying functionally important features

  • Multi-omics integration:

    • Combine genomic (SNP data) , transcriptomic, proteomic, and metabolomic data

    • Implement network analysis approaches to identify key regulatory nodes

    • Use pathway enrichment analysis to contextualize findings

  • Bayesian network analysis:

    • Model causal relationships between genetic variants, molecular mechanisms, and behavioral outcomes

    • Update models as new evidence becomes available

    • Incorporate prior knowledge from literature and databases

  • Standardized data reporting:

    • Use consistent formats and identifiers across studies

    • Include detailed methodological information to facilitate meta-analyses

    • Deposit data in public repositories with appropriate metadata

What are the most promising applications of CHRM2 research in precision medicine?

The most promising applications of CHRM2 research in precision medicine include:

  • Pharmacogenomics-guided therapy:

    • Using CHRM2 genetic variants to predict response to muscarinic modulators

    • Personalizing dosage regimens based on genetic profiles

    • The identified associations between CHRM2 variants and substance use behaviors could inform personalized addiction treatment approaches

  • Targeted therapy development:

    • Developing allosteric modulators that can selectively enhance or inhibit specific CHRM2 signaling pathways

    • Creating biased ligands that activate beneficial signaling pathways while minimizing unwanted effects

    • The differential effects of LY2119620 on G-protein and β-arrestin pathways provide a foundation for designing pathway-selective compounds

  • Biomarker development:

    • Using CHRM2 expression patterns or signaling signatures as biomarkers for disease progression

    • Developing imaging agents that can detect alterations in CHRM2 density or function in vivo

  • Patient stratification approaches:

    • Identifying subgroups of patients with specific CHRM2-related endophenotypes

    • Tailoring treatment approaches based on molecular profiles

    • The association of CHRM2 with cognitive performance could inform cognitive enhancement strategies in personalized medicine

  • Disease risk prediction:

    • Incorporating CHRM2 genetic information into risk models for substance use disorders

    • The identified association of rs1455858 with substance use behaviors provides a foundation for such models

How might novel technologies advance our understanding of CHRM2 dynamics in living systems?

Novel technologies are poised to revolutionize our understanding of CHRM2 dynamics in living systems:

  • Advanced imaging technologies:

    • Single-molecule microscopy to track individual CHRM2 molecules in living cells

    • Super-resolution microscopy (STORM, PALM) to visualize CHRM2 nanoclusters and their dynamics

    • Lattice light-sheet microscopy to capture CHRM2 trafficking in 3D with minimal phototoxicity

  • Biosensor technologies:

    • Genetically encoded sensors that can report CHRM2 conformational changes in real-time

    • FRET/BRET-based sensors that can simultaneously monitor multiple signaling pathways

    • Optogenetic tools to control CHRM2 activity with spatiotemporal precision

  • Single-cell technologies:

    • Single-cell transcriptomics to map CHRM2 expression across cell types

    • Single-cell proteomics to examine cell-specific CHRM2 signaling networks

    • Spatial transcriptomics to map CHRM2 expression in tissue contexts

  • In vivo recording technologies:

    • Miniaturized microscopes for imaging CHRM2 activity in freely moving animals

    • Fiber photometry to record CHRM2-dependent signaling in deep brain structures

    • Wireless recording devices to monitor CHRM2-mediated physiological responses

  • AI and computational approaches:

    • Deep learning algorithms to predict CHRM2 ligand interactions

    • Machine learning approaches to identify patterns in complex CHRM2 signaling datasets

    • In silico modeling to predict CHRM2 conformational dynamics and drug responses

What are the current hypotheses about CHRM2's role in complex neuropsychiatric conditions?

Current hypotheses about CHRM2's role in complex neuropsychiatric conditions are evolving based on genetic, structural, and functional evidence:

  • Substance use disorders hypothesis:

    • CHRM2 variants influence risk for broad externalizing behaviors and substance use disorders

    • Temperamental traits related to behavioral disinhibition (impulsivity, sensation seeking) mediate the association between CHRM2 variation and substance use

    • This hypothesis is supported by evidence showing significant associations between rs1455858 and measures of substance use and disinhibition in high-risk adolescents

  • Cognitive function hypothesis:

    • CHRM2 influences cognitive abilities, particularly in populations with elevated risk for substance use

    • This hypothesis is supported by multiple studies linking CHRM2 to measures of cognitive ability

    • The mechanism may involve M2 receptor-mediated modulation of synaptic plasticity, learning, memory, and attention

  • Neurodevelopmental pathway hypothesis:

    • CHRM2 influences brain development through regulation of neuronal differentiation and circuit formation

    • Alterations in these processes could contribute to risk for various neuropsychiatric conditions

    • This hypothesis connects CHRM2's role in cellular signaling with its genetic associations to complex behaviors

  • Cholinergic signaling imbalance hypothesis:

    • Dysregulation of M2 receptor-mediated inhibition of acetylcholine release leads to imbalanced cholinergic signaling

    • This imbalance contributes to cognitive and affective symptoms in neuropsychiatric conditions

    • The hypothesis is supported by CHRM2's role in regulating acetylcholine release and dopamine signaling

  • Conformational dynamics hypothesis:

    • Different CHRM2 conformational states preferentially couple to different signaling pathways

    • Genetic or environmental factors that alter this conformational landscape could contribute to disease risk

    • This hypothesis connects structural insights from cryo-EM studies with genetic association findings

What databases and repositories contain valuable information for CHRM2 researchers?

Several specialized databases and repositories contain valuable information for CHRM2 researchers:

Database CategorySpecific ResourcesInformation Type
Protein DatabasesUniProtKB (P08172, Q9ERZ4, P10980) Sequence, function, PTMs
Structural DatabasesAlphaFold (P08172, Q9ERZ4, P10980) Predicted protein structures
Pharmacological DatabasesGuide to Pharmacology Ligand information, binding data
Chemical DatabasesChEMBL (CHEMBL211, CHEMBL3197, CHEMBL309) Compound bioactivity data
Clinical DatabasesOMIM (118493) Disease associations
Genomic DatabasesEnsembl (ENSG00000181072) Genomic information
KEGG (hsa:1129, mmu:243764, rno:81645) Pathway information
Drug DatabasesDrugBank (P08172) Drug targets and interactions
Protein AtlasHuman Protein Atlas (ENSG00000181072) Expression patterns
Structural ResourcesSynPHARM (1190) Ligand-binding information

Researchers should refer to these databases for up-to-date information on CHRM2 sequence, structure, function, ligands, and disease associations. Regular updates to these resources ensure access to the latest findings in the field.

What are the recommended experimental controls for CHRM2 research?

Implementing appropriate controls is crucial for robust CHRM2 research:

  • Expression system controls:

    • Empty vector/untransfected cells to control for background signals

    • Cells expressing related receptors (other muscarinic subtypes) to assess specificity

    • Expression level measurements (western blot, qPCR) to normalize for expression differences

  • Pharmacological controls:

    • Well-characterized orthosteric agonists (acetylcholine, iperoxo)

    • Known antagonists to confirm receptor-specific effects

    • Subtype-selective compounds when available

    • Vehicle controls for all compounds

  • Binding assay controls:

    • Non-specific binding controls (measured in the presence of excess unlabeled ligand)

    • Saturation binding experiments to determine Bmax and Kd values

    • Competition binding with reference compounds

  • Functional assay controls:

    • Positive controls with known efficacy profiles

    • Negative controls (receptor blockers, pathway inhibitors)

    • Kinetic controls to establish appropriate time points

  • Antibody controls:

    • Negative controls (isotype controls, secondary antibody only)

    • Tissue/cells known to express or lack CHRM2

    • Blocking peptides to verify antibody specificity

    • For the monoclonal antibody mentioned, appropriate isotype control would be IgG1,κ

  • Genetic controls:

    • Knockout/knockdown controls to verify specificity

    • Wild-type comparisons for mutant studies

    • Hardy-Weinberg equilibrium verification for genetic studies

What methodological pitfalls should researchers be aware of when studying CHRM2?

Researchers studying CHRM2 should be aware of several methodological pitfalls:

  • Antibody specificity issues:

    • Many commercially available antibodies lack sufficient validation

    • Always validate antibody specificity using appropriate controls

    • Use recommended dilutions (e.g., WB1:500, IHC-P1:25, FC~~1:25)

    • Verify cross-reactivity when working with bovine CHRM2

  • Expression system artifacts:

    • Overexpression can lead to non-physiological signaling patterns

    • Choice of host cell can influence receptor coupling preferences

    • Presence/absence of specific G-proteins in heterologous systems can bias results

  • Species differences misinterpretation:

    • Extrapolating findings across species without validation

    • Overlooking subtle pharmacological differences between species

    • Using reagents optimized for one species on another without validation

  • Conformational state considerations:

    • Failing to account for receptor conformational heterogeneity

    • Different ligands stabilize different conformational states with distinct signaling properties

    • Storage conditions can affect receptor conformation and function

  • Genetic association study limitations:

    • Inadequate sample sizes leading to underpowered studies

    • Lack of appropriate multiple testing correction

    • Failure to account for population stratification

    • Not considering linkage disequilibrium patterns

  • Biased signaling assessment challenges:

    • Using single readouts that may miss pathway-specific effects

    • Failing to normalize data appropriately when comparing pathways

    • Not accounting for differences in assay sensitivity between pathways

  • Allosteric modulator complexities:

    • Probe dependence (effects depend on the orthosteric ligand present)

    • Potential for complex cooperative effects

    • Kinetic aspects of allosteric modulation that may be missed in endpoint assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.