Recombinant Bovine Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Description

General Overview and Classification

Muscarinic acetylcholine receptor M3 belongs to the G protein-coupled receptor (GPCR) superfamily, specifically within the class A/1 (rhodopsin-like) receptor category. The CHRM3 gene encodes this integral membrane protein that spans the cellular membrane multiple times with its characteristic seven-transmembrane domain structure. As a muscarinic receptor, it responds specifically to the neurotransmitter acetylcholine, distinguishing it from nicotinic acetylcholine receptors that function as ion channels .

The M3 receptor subtype represents one of five muscarinic receptor subtypes (M1-M5), each with distinct tissue distribution and signaling properties. While the search results focus primarily on human CHRM3, the bovine variant would be expected to maintain the core structural and functional characteristics due to the high conservation of these receptors across mammalian species. The bovine CHRM3 likely maintains similar tissue expression patterns, being found predominantly in smooth muscle, cardiac tissue, and various secretory glands .

Evolutionary Conservation and Species Differences

Muscarinic receptors are highly conserved across mammalian species, reflecting their essential physiological roles. While the search results do not specifically detail bovine CHRM3, they indicate that CHRM3 antibodies may have cross-reactivity with multiple species, including cow, suggesting significant homology in protein structure . This conservation is particularly important for researchers developing tools to study these receptors across different model organisms and agricultural species.

Despite this conservation, species-specific variations in amino acid sequences may exist, potentially affecting ligand binding properties, signaling efficiency, or regulatory mechanisms. These subtle differences highlight the importance of species-specific recombinant proteins for comparative studies and the development of targeted therapeutic approaches in veterinary medicine.

Protein Structure and Domains

The CHRM3 protein features the characteristic seven-transmembrane domain architecture of GPCRs. Based on data from human CHRM3, the receptor consists of several key structural components: an extracellular N-terminal domain, seven transmembrane helices connected by alternating intracellular and extracellular loops, and an intracellular C-terminal domain . The third intracellular loop is particularly large in muscarinic receptors and plays a crucial role in G-protein coupling and downstream signaling specificity.

The acetylcholine binding site is formed by residues from multiple transmembrane domains, creating a pocket that specifically recognizes this neurotransmitter. Studies on human CHRM3 have identified critical residues involved in ligand binding and receptor activation, with many of these likely conserved in the bovine variant due to their essential functional roles .

Molecular Weight and Physical Characteristics

Based on the information from recombinant human CHRM3, the partial protein (positions 253-492) has a molecular weight of approximately 28.7 kDa . The full-length bovine CHRM3 would likely have a comparable molecular weight, though exact values may vary slightly due to species-specific differences in amino acid composition or post-translational modifications.

The physical properties of CHRM3, including its hydrophobicity profile and glycosylation patterns, contribute to its proper folding, membrane insertion, and trafficking within cells. These characteristics are crucial considerations when producing recombinant versions of the protein for research or therapeutic applications.

Signaling Pathways

The primary signaling mechanism of CHRM3 involves coupling to Gq/11 proteins upon acetylcholine binding. This interaction triggers a cascade of downstream events that include:

  1. Activation of phospholipase C

  2. Hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) to generate inositol triphosphate (IP3) and diacylglycerol (DAG)

  3. IP3-mediated release of calcium from intracellular stores

  4. DAG-mediated activation of protein kinase C (PKC)

This signaling cascade ultimately leads to various cellular responses depending on the cell type and physiological context. In smooth muscle cells, increased intracellular calcium promotes contraction, while in secretory cells, it stimulates exocytosis and release of secretory products.

Physiological Functions

The CHRM3 receptor mediates numerous physiological processes across different tissues and organ systems:

Tissue/Organ SystemCHRM3-Mediated Functions
Smooth MuscleContraction of gastrointestinal, urinary, respiratory, and vascular smooth muscle
Cardiac TissueRegulation of heart rate and contractility
Exocrine GlandsStimulation of secretions (salivary, lacrimal, digestive)
Urinary BladderControl of bladder contraction and urination
AirwaysBronchoconstriction and mucus secretion
Gastrointestinal TractRegulation of peristalsis and digestive secretions
Blood VesselsVasodilation through endothelial nitric oxide production

In bovine physiology, CHRM3 likely plays crucial roles in regulating digestive function, including ruminal motility and secretory processes, as well as in other organ systems similar to those documented in humans and other mammals .

Pathophysiological Implications

Dysfunction of CHRM3 signaling has been implicated in various pathological conditions. While most research has focused on human diseases, similar mechanisms may apply to bovine health conditions:

  1. Gastrointestinal disorders: Altered contractility and secretory function

  2. Respiratory conditions: Bronchoconstriction and increased mucus production

  3. Urinary dysfunction: Detrusor muscle hyperactivity or hypoactivity

  4. Cardiovascular abnormalities: Dysregulation of vasodilation and cardiac function

Research in human disease models indicates that mutations in CHRM3 can lead to specific syndromes, such as the Eagle-Barrett syndrome characterized by urinary tract abnormalities, thin abdominal musculature, and cryptorchidism . The potential role of CHRM3 dysfunction in bovine disease states remains an area for further investigation.

Expression Systems and Methodology

The production of recombinant CHRM3 can be accomplished using various expression systems, each with distinct advantages for specific applications. Based on information from human CHRM3 production, the following expression systems are commonly employed:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential improper foldingVariable (0.02-1 mg)
YeastModerate cost, some post-translational modificationsNot identical to mammalian modificationsVariable (0.02-1 mg)
Baculovirus/Insect CellsBetter protein folding, more mammalian-like modificationsHigher cost, longer production timeVariable (0.02-1 mg)
Mammalian CellsMost authentic post-translational modifications, proper foldingHighest cost, lowest yield, technically demandingVariable (0.02-0.5 mg)

For membrane proteins like CHRM3, mammalian and insect cell expression systems often provide advantages for maintaining proper protein folding and functional integrity, despite their higher cost . The choice of expression system depends on the specific research requirements, such as whether native receptor function or high protein yield is prioritized.

Purification and Quality Control

Purification of recombinant CHRM3 typically involves affinity chromatography approaches, often utilizing epitope tags incorporated into the recombinant protein. Quality control measures for recombinant CHRM3 production include:

  1. SDS-PAGE analysis to confirm molecular weight and purity

  2. Western blotting to verify protein identity

  3. Mass spectrometry for detailed structural characterization

  4. Functional assays to confirm ligand binding and signaling properties

  5. Stability testing under various storage conditions

For recombinant bovine CHRM3, validation of species specificity would be an additional critical quality control step, potentially involving peptide mapping or sequencing to confirm the bovine-specific amino acid sequence .

Antibodies and Detection Methods

Various antibodies targeting CHRM3 are available for research applications, though most are developed against human CHRM3. Some demonstrate cross-reactivity with multiple species, including bovine tissue, making them potentially useful for studying bovine CHRM3 . These antibodies can be applied in techniques such as:

  1. Western blotting for protein expression quantification

  2. Immunohistochemistry for tissue localization studies

  3. Immunofluorescence for subcellular localization

  4. ELISA for quantitative detection

  5. Flow cytometry for cell surface expression analysis

The availability of monoclonal antibodies with defined epitopes offers advantages for specific detection applications, while polyclonal antibodies may provide broader epitope recognition . For bovine-specific research, antibodies would ideally be validated specifically for bovine CHRM3 reactivity.

Research Applications

Recombinant bovine CHRM3 serves numerous research purposes:

  1. Receptor pharmacology studies to screen potential agonists and antagonists

  2. Structure-function analyses to understand species-specific aspects of receptor signaling

  3. Development of selective ligands for veterinary applications

  4. Comparative studies between human and bovine receptor properties

  5. Investigation of species-specific differences in drug responses

  6. Research into bovine-specific physiological regulatory mechanisms

These applications contribute to our fundamental understanding of muscarinic receptor biology while potentially informing the development of veterinary therapeutics targeting these receptors .

Potential Veterinary Applications

Understanding bovine CHRM3 has several potential applications in veterinary medicine:

  1. Development of selective muscarinic modulators for treating bovine gastrointestinal disorders

  2. Management of respiratory conditions in cattle

  3. Potential approaches for addressing reproductive or urinary dysfunction

  4. Therapeutic strategies for disorders involving excessive or insufficient glandular secretions

The role of CHRM3 in regulating smooth muscle contraction makes it particularly relevant for conditions affecting digestive, respiratory, and urinary function in cattle .

Future Research Directions

Several promising areas for future research on bovine CHRM3 include:

  1. Comprehensive characterization of bovine-specific amino acid sequences and potential structural differences

  2. Species-comparative pharmacology to identify selective ligands

  3. Investigation of tissue-specific expression patterns in bovine organs

  4. Studies on the role of CHRM3 in bovine disease states

  5. Development of bovine-specific antibodies and detection reagents

  6. Exploration of CHRM3 regulation during different physiological states (e.g., lactation, pregnancy)

  7. Potential genetic variations in CHRM3 across different cattle breeds and their functional implications

These research directions would enhance our understanding of this important receptor in bovine physiology while potentially leading to novel veterinary applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MTLHNNNTTSPLFPNISSSWIHGPSDTGLPPGTVTHFGSYNISRAAGNLSSPNGTTSDPL GGHTIWQVVFIAFLTGVLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSM KRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGSVGLERKPSKLQTQQSMDDGGSF QKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN PVCYALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Uniprot No.

Target Background

Function

The muscarinic acetylcholine receptor M3 (CHRM3) mediates diverse cellular responses, including inhibition of adenylate cyclase, phosphoinositide breakdown, and modulation of potassium channels via G protein signaling. The primary transduction effect is phosphatidylinositol turnover.

Gene References Into Functions
  1. Sequential activation of muscarinic M3 and cannabinoid CB1 receptors synergistically contracts bovine ciliary muscle by activating Rho-kinase and protein kinase C. PMID: 23396229
  2. Findings support a novel transduction cascade involving Gαq/16βγ coupling of M3AChR to natriuretic peptide receptor-guanylyl cyclase (NPR-GC). PMID: 17613728
  3. Airway M2 receptors inhibit BK channels via a dual Gβγ-mediated mechanism: direct membrane-delimited interaction and activation of the phospholipase C/protein kinase C pathway. PMID: 18524769
Database Links

KEGG: bta:281685

STRING: 9913.ENSBTAP00000010601

UniGene: Bt.501

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M3 and what are its primary cellular functions?

The Muscarinic Acetylcholine Receptor M3 (CHRM3) is one of five G protein-coupled receptors (GPCRs) in the muscarinic acetylcholine receptor family. It belongs to the rhodopsin-like (class A) receptor classification and functions primarily through the Gq/11 signaling pathway . The receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G protein-mediated actions .

The primary transducing effect of CHRM3 activation is phosphoinositide (Pi) turnover . This receptor is widely expressed in both the central nervous system and peripheral tissues, where it plays crucial roles in numerous physiological processes . CHRM3 activation triggers a signaling cascade that ultimately leads to calcium mobilization and cellular responses specific to the tissue type in which it is expressed.

What structural features distinguish CHRM3 from other muscarinic receptor subtypes?

Although the five mAChR subtypes (M1-M5) share a high degree of sequence homology, they show pronounced differences in G protein coupling preference and the physiological responses they mediate . The M3 receptor specifically couples primarily with Gq/11 proteins, distinguishing it from subtypes like M2 that preferentially couple with Gi/o proteins .

The M3 receptor contains several structurally significant regions, including a large third intracellular loop (ICL3) that spans residues 260-481 in the wild-type receptor . This region is particularly important for G protein interactions but presents challenges for structural studies due to its size and potential disorder . Recent structural analyses have enabled comparisons between M3 and other muscarinic receptor subtypes, revealing subtle differences that contribute to their distinct coupling preferences and pharmacological profiles .

What expression systems are optimal for producing recombinant bovine CHRM3?

For successful expression of recombinant bovine CHRM3, insect cell expression systems, particularly Sf9 cells, have proven highly effective for structural and functional studies . This expression system offers advantages for GPCR expression, including proper folding and post-translational modifications while providing sufficient yields for purification and subsequent analyses.

For mammalian expression, HEK293 or COS-7 cell lines are commonly employed, especially when studying signaling mechanisms in a more native-like environment . These systems are particularly valuable when assessing functional properties such as ligand binding or signal transduction. When designing expression constructs, researchers should consider modifications that enhance expression and stability while preserving the pharmacological properties of interest, such as:

  • Addition of affinity tags (hexahistidine, FLAG) for purification

  • Inclusion of protease cleavage sites (TEV) for tag removal

  • Strategic modifications of potentially disordered regions like ICL3

  • Codon optimization for the selected expression system

What purification strategies yield functional CHRM3 protein for structural studies?

Purification of functional CHRM3 for structural and biophysical studies typically employs a multi-step approach designed to maintain receptor stability and functionality . An effective purification workflow includes:

  • Cell membrane preparation through mechanical disruption followed by differential centrifugation

  • Solubilization using appropriate detergents that maintain receptor structure

  • Initial capture using nickel affinity chromatography via the hexahistidine tag

  • Secondary affinity purification via FLAG antibody chromatography

  • Final polishing through size exclusion chromatography

For crystallization studies specifically, researchers have successfully used modified constructs where the third intracellular loop (residues 260–481) is replaced with T4 lysozyme residues 1-161 . This modification significantly improves crystallization properties while maintaining the receptor's ability to bind ligands with appropriate affinity . The purified receptor can then be reconstituted into lipidic cubic phase for crystallization trials, which has proven successful for obtaining diffraction-quality crystals of the M3 receptor .

How does CHRM3 couple with G proteins at the molecular level?

The coupling between CHRM3 and its cognate G proteins occurs through specific molecular interactions that have been elucidated through hydrogen-deuterium exchange mass spectrometry and NanoLuc Binary Technology-based cell systems . The coupling process involves dynamic interactions between the receptor's intracellular domains and the G protein heterotrimers, particularly the Gαq subunit .

Recent studies have revealed specific binding interfaces that form between M3 and Gq in both pre-assembled complexes (receptor-G protein complexes formed before agonist binding) and functionally active complexes (those that form or change conformation after agonist binding) . Interestingly, the third intracellular loop (ICL3) of M3 has been found to negatively affect M3-Gq coupling, suggesting it may play a regulatory role in controlling signaling efficiency .

During M3-Gq coupling, the Gαq alpha-helical domain (AHD) undergoes unique conformational changes that are essential for proper signal transduction . These structural rearrangements facilitate GDP release from the G protein, a critical step in the activation cycle. Understanding these molecular mechanisms provides insights into the functioning of this important signaling system and offers potential avenues for therapeutic intervention.

What conformational changes occur in CHRM3 during agonist and antagonist binding?

Ligand binding to CHRM3 induces specific conformational changes that determine receptor activation state and subsequent signaling outcomes . When agonists bind, the receptor undergoes structural rearrangements that favor G protein coupling and activation. Conversely, antagonist binding stabilizes conformations that prevent G protein activation.

Molecular dynamics simulations have provided valuable insights into the binding pathways of ligands like tiotropium to muscarinic receptors . These simulations reveal that ligands may bind transiently to allosteric sites en route to the orthosteric binding pocket . This finding suggests that ligands navigate a complex energy landscape during association with the receptor, potentially influencing their binding kinetics and residence times.

The structural comparison between agonist-bound and antagonist-bound states reveals differences in the arrangement of transmembrane helices, particularly TM5 and TM6, which are critical for G protein coupling . These conformational changes propagate from the ligand binding pocket to the intracellular surface of the receptor, creating binding sites for downstream signaling partners like G proteins and arrestins.

What methods are most effective for studying CHRM3 pharmacology in vitro?

Several complementary techniques have proven valuable for investigating CHRM3 pharmacology in controlled laboratory settings:

  • Radioligand binding assays: These assays use radiolabeled ligands such as [³H]-QNB to determine binding affinities and kinetics for various compounds interacting with CHRM3 . This approach allows precise measurement of association and dissociation constants, revealing important aspects of ligand-receptor interactions.

  • Functional signaling assays: Since CHRM3 primarily couples to Gq/11, assays measuring calcium mobilization or phosphoinositide hydrolysis provide functional readouts of receptor activation . These can be performed in cell lines expressing native or recombinant receptors.

  • Hydrogen-deuterium exchange mass spectrometry: This technique has recently been applied to study the dynamic interactions between full-length wild-type M3 and Gq proteins, offering insights into structural changes occurring during receptor activation and G protein coupling .

  • NanoLuc Binary Technology-based cell systems: These bioluminescence-based approaches allow real-time monitoring of protein-protein interactions in living cells, providing information about receptor-G protein coupling dynamics .

  • Western blot analysis: Using specific antibodies, such as mouse polyclonal muscarinic acetylcholine receptor M3/CHRM3 antibody at concentrations around 1 μg/mL, researchers can detect and quantify receptor expression in various preparations . When performing Western blots for CHRM3, the predicted band size is approximately 66 kDa .

How can researchers validate the functionality of recombinant CHRM3 constructs?

Validating the functionality of recombinant CHRM3 constructs is essential to ensure that experimental modifications haven't compromised the receptor's native properties . A comprehensive validation approach includes:

  • Pharmacological comparison with wild-type receptors: Comparing the binding affinities of various ligands between modified constructs and wild-type receptors through radioligand binding assays . Both antagonist and agonist binding profiles should be examined, as some modifications may differentially affect these interactions.

  • Dissociation rate kinetics: Measuring the dissociation kinetics of radiolabeled antagonists like [³H]-QNB to verify that ligand binding properties remain similar between wild-type and modified receptors .

  • Signal transduction assessment: For constructs intended to maintain signaling capabilities, validation should include measurement of downstream effects like phosphoinositide hydrolysis in response to agonists .

  • Structural integrity verification: Biophysical techniques such as circular dichroism or thermal stability assays can confirm that the modified receptor maintains proper folding and stability.

What approaches can facilitate the design of CHRM3 subtype-selective ligands?

  • Structure-based drug design: Recent structural studies comparing M3 and M2 receptors offer new possibilities for rational design of subtype-selective compounds . Understanding the subtle structural differences between receptor subtypes can guide the development of ligands that preferentially interact with specific receptor subtypes.

  • Allosteric modulation: Molecular dynamics simulations have revealed that ligands like tiotropium bind transiently to allosteric sites en route to the orthosteric binding pocket . These allosteric sites often show greater sequence diversity between receptor subtypes and thus represent attractive targets for developing subtype-selective compounds.

  • Bitopic ligands: These hybrid compounds simultaneously engage both orthosteric and allosteric sites, potentially achieving greater selectivity by exploiting the combined interaction profiles.

  • Binding kinetics optimization: Different receptor subtypes may exhibit distinct kinetic profiles for ligand binding and dissociation. Designing ligands with specific kinetic properties may achieve functional selectivity even when equilibrium binding parameters are similar across subtypes .

  • Receptor activation state targeting: Designing ligands that selectively stabilize particular receptor conformations can potentially achieve subtype selectivity despite high sequence conservation in the binding pocket.

How do CHRM3 genetic variations correlate with disease susceptibility?

Several studies have investigated the relationship between CHRM3 genetic variations and disease susceptibility, revealing potential associations with various conditions :

  • Neurodevelopmental disorders: Case studies have identified patients with CHRM3 deletions or duplications who present with autism features, intellectual disabilities, developmental delay, and cranial abnormalities such as strabismus . For instance, a patient with a 473 kb deletion removing the first four exons of CHRM3 presented with autism features, intellectual disabilities, strabismus, and cranial nerve VI palsy .

  • Psychiatric conditions: Genome-wide CNV analysis on a predominantly Japanese population found that a small intergenic deletion affecting CHRM3 was significantly more frequent in schizophrenia cases than in controls (odds ratio = 3.04, P = 9.3 × 10⁻⁹, present in 9.0% of cases) .

  • Visual disorders: Significant associations have been reported between copy number gains (3-5 copies) of CHRM3 and high myopia in Han Chinese populations, suggesting that CHRM3 overexpression may be a risk factor for this common visual disorder .

  • Physical abnormalities: Some patients with CHRM3 variations have presented with additional features such as cryptorchidism, short stature, hand anomalies, and clinodactyly, indicating potential developmental roles for this receptor .

While these associations suggest important roles for CHRM3 in various physiological and developmental processes, the evidence remains limited and sometimes contradictory . Further research is needed to establish clear causal relationships and elucidate the underlying mechanisms by which CHRM3 variations influence disease susceptibility.

What are the therapeutic implications of targeting CHRM3 in various pathological conditions?

The M3 muscarinic acetylcholine receptor is implicated in several pathological conditions, making it an important therapeutic target :

The recent structural characterization of the M3 receptor bound to tiotropium provides valuable insights for drug development . Despite decades of effort, few therapeutic agents with clear mAChR subtype selectivity have been developed . The structural comparison between M3 and other mAChR subtypes offers new possibilities for designing more selective therapeutic agents with improved efficacy and reduced side effects .

How does species variation in CHRM3 affect drug development and preclinical testing?

Species variations in CHRM3 structure and function present important considerations for drug development and translational research:

  • Sequence divergence: While muscarinic receptors are generally well-conserved across mammalian species, subtle sequence differences can significantly impact drug binding properties and signaling responses. These differences must be considered when translating findings from animal models to human applications.

  • Pharmacological profiling across species: When developing drugs targeting CHRM3, comprehensive pharmacological profiling in multiple species is essential to identify potential species-specific responses. This includes comparing binding affinities, functional potencies, and off-target effects across species variants of the receptor.

  • Model selection for preclinical testing: Based on receptor homology and pharmacological similarity to human CHRM3, certain species may provide more predictive models for specific applications. For instance, bovine CHRM3 may be more appropriate for certain studies based on its homology with human CHRM3 and tissue-specific expression patterns.

  • Interpretation of animal study results: When interpreting preclinical data, researchers must account for species differences in CHRM3 distribution, density, and coupling efficiency with downstream signaling partners. These factors can significantly impact drug efficacy and side effect profiles between species.

  • Translation to clinical applications: Successful translation from preclinical models to human applications requires careful consideration of species differences. In vitro testing with human CHRM3 should complement animal studies to better predict clinical outcomes.

Understanding species-specific variations in CHRM3 structure and function is essential for developing drugs with optimal efficacy and safety profiles. This knowledge helps researchers select appropriate model systems and interpret preclinical data in ways that maximize translational value for human therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.