Recombinant Bovine Myelin and lymphocyte protein (MAL)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Structure

Recombinant Bovine MAL (UniProt ID: Q3ZBY0) is a 17-kDa hydrophobic integral membrane protein with four transmembrane domains. It consists of 153 amino acids, including the sequence:
MAPSAASGVSSLPSGFAVFTTFPDLLFIFEFVFGGLVWILVSSSHVPIPLIQGWVMFASV FCFVATTVLAFLYVIGAHGNRTSWITLDAAYHCVASLFYFGASVLEALAAIQLQDGFLYK YYHENISAVVFSYVATLLYVVHAVFSLIRWKSS .

PropertyValue
Molecular Weight16,784 Da
Subcellular LocalizationMembrane (Multi-pass)
Expression SystemE. coli with N-terminal His tag
Purity>90% (SDS-PAGE verified)

Functional Roles in Biology

MAL is critical for:

  • Vesicular Trafficking: Directs apical transport of proteins in polarized epithelial cells and stabilizes lipid rafts .

  • Myelin Biogenesis: Facilitates sorting of myelin proteolipid protein (PLP) and neurofascin 155 in oligodendrocytes and Schwann cells .

  • Immune Signaling: Regulates T-cell receptor (TCR) signaling by transporting Src-like kinases (e.g., Lck) to lipid rafts .

In bovine models, MAL deficiency disrupts GPI-anchored protein trafficking, while overexpression alters Schwann cell differentiation and reduces myelin protein zero (Mpz) expression .

Production and Characterization

Recombinant Bovine MAL is produced via E. coli expression systems, followed by affinity chromatography for His-tag purification . Key quality control metrics include:

ParameterSpecification
Storage BufferTris/PBS, 6% Trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water
StabilityStable at -80°C; avoid freeze-thaw
ApplicationsELISA, Western blot, cell assays

Role in Schwann Cell Differentiation

  • MAL overexpression reduces Mpz and p75NTR expression in primary mouse Schwann cells, delaying myelination .

  • Alters cytoskeletal dynamics via RhoU and Krt23 downregulation, affecting membrane protrusion formation .

Oncogenic Implications

  • MAL is overexpressed in ovarian cancer and lymphomas, promoting tumor progression .

  • Conversely, MAL silencing impairs exosome secretion in T-cells, suggesting context-dependent roles in cancer .

Challenges and Future Directions

  • Dual Role in Cancer: MAL’s pro- and anti-tumor effects require further mechanistic studies .

  • Therapeutic Targeting: Potential for MAL-based interventions in multiple sclerosis and neuropathies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAL; Myelin and lymphocyte protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MAL
Target Protein Sequence
MAPSAASGVSSLPSGFAVFTTFPDLLFIFEFVFGGLVWILVSSSHVPIPLIQGWVMFASV FCFVATTVLAFLYVIGAHGNRTSWITLDAAYHCVASLFYFGASVLEALAAIQLQDGFLYK YYHENISAVVFSYVATLLYVVHAVFSLIRWKSS
Uniprot No.

Target Background

Function
This protein could play a crucial role in vesicular trafficking, cycling between the Golgi complex and the apical plasma membrane. It might also be involved in myelin biogenesis and/or myelin function.
Gene References Into Functions
  1. SYP is an hexameric MAL-domain channel protein. PMID: 17562317
Database Links
Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Myelin and Lymphocyte protein (MAL) and what is its primary function?

Myelin and Lymphocyte protein (MAL) is a 17 kDa proteolipid that functions as a key component in lipid rafts, specialized membrane microdomains rich in cholesterol and sphingolipids. MAL plays crucial roles in both the nervous system and immune cells. In myelin-forming cells, MAL is involved in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane . Research indicates that MAL is important for targeting proteins and lipids to distinct domains and is considered a critical component in myelin biogenesis and/or myelin function . The proper expression and function of MAL are essential for normal myelination processes, particularly in the peripheral nervous system where it participates in the coordinated reciprocal signaling between Schwann cells and axons necessary for accurate myelination .

How is MAL expression regulated during Schwann cell development?

MAL expression is tightly regulated during Schwann cell development and myelination. Studies have shown that MAL overexpression impedes peripheral myelinogenesis, causing a delayed onset of myelination and reduced expression of the myelin protein zero (Mpz/P0) and the low-affinity neurotrophin receptor p75NTR . This effect occurs early in Schwann cell development, as reduced expression of Mpz and p75NTR is evident even before differentiation in primary mouse Schwann cell cultures overexpressing MAL . This suggests that MAL plays a regulatory role in early Schwann cell development that ultimately influences myelination processes.

The effects of MAL overexpression on gene expression are not mediated through alterations in major transcription factors, as most transcription factors known to regulate Schwann cell differentiation and myelination (except for a small reduction in Sox10) remain largely unchanged in MAL-overexpressing Schwann cells .

What methodological approaches are used to detect and quantify MAL protein?

Several methodological approaches are commonly employed to detect and quantify MAL protein in research settings:

  • Enzyme-Linked Immunosorbent Assay (ELISA): Sandwich ELISA kits specifically designed for MAL detection provide precise measurements of MAL protein levels in various sample types including serum, plasma, tissue homogenates, and cell culture supernatants . These assays typically offer:

    • Detection ranges of 0.312-20 ng/mL

    • Sensitivity levels of approximately 0.156 ng/mL

    • Compatibility with multiple sample types

  • Immunofluorescence Microscopy: This technique enables visualization of MAL localization within cells and tissues. Studies have used this approach to determine the subcellular distribution of MAL and MAL-regulated proteins in Schwann cells, revealing localization patterns in cytoplasm, membrane protrusions, and cellular processes .

  • Quantitative Real-Time PCR (qRT-PCR): For analysis of MAL expression at the transcriptional level, qRT-PCR provides quantitative measurements of mRNA levels. This approach has been used to detect the significant overexpression of Mal mRNA in both treated and untreated conditions in Schwann cells derived from MAL-overexpressing mice .

  • Whole Genome Expression Assays: For comprehensive analysis of MAL-dependent gene expression changes, microarray analyses covering more than 45,000 transcripts have been employed to identify differentially expressed genes in MAL-overexpressing cells compared to wild-type controls .

How do different species variants of MAL protein compare structurally and functionally?

Bovine MAL protein shares structural and functional similarities with MAL proteins from other mammalian species, though with species-specific variations that may influence its precise biological activity. When designing experiments with recombinant bovine MAL, researchers should consider these cross-species similarities and differences.

The MAL protein is known by several synonyms across species, including:

  • 17 kDa myelin vesicular protein

  • T-lymphocyte maturation-associated protein

  • MVP17/Mvp17

Structurally, MAL proteins generally contain multiple transmembrane domains that facilitate their association with lipid rafts. While the search results don't provide detailed structural information specific to bovine MAL, research approaches to investigate species-specific differences typically include sequence homology analysis, functional complementation studies, and comparative analysis of interaction networks.

What are the optimal conditions for producing recombinant bovine MAL protein?

Production of functional recombinant bovine MAL requires careful consideration of expression systems and purification strategies due to its nature as a membrane-associated proteolipid. While specific protocols for bovine MAL are not detailed in the search results, methodological considerations should include:

  • Expression System Selection: For proper folding and post-translational modifications, eukaryotic expression systems (mammalian, insect, or yeast cells) are generally preferred over bacterial systems for membrane proteins like MAL.

  • Solubilization Strategy: As a membrane protein, MAL requires appropriate detergents or lipid environments for solubilization while maintaining native conformation.

  • Purification Approach: Affinity chromatography techniques using epitope tags (His-tag, GST-tag) facilitate isolation of the recombinant protein while minimizing native protein contamination.

  • Quality Control: Verification of protein identity, purity, and functionality through techniques such as mass spectrometry, circular dichroism, and functional assays is essential for ensuring research-grade quality.

How does MAL overexpression affect gene expression patterns in myelin-forming cells?

MAL overexpression induces significant changes in gene expression patterns in Schwann cells, particularly affecting genes involved in myelination and cytoskeletal organization. Whole genome expression analysis of primary mouse Schwann cells has revealed:

  • Myelin-Related Genes: MAL overexpression leads to approximately 50% reduction in Mpz mRNA expression under both unstimulated (p < 0.0001) and forskolin-stimulated (p < 0.007) conditions . Similarly, p75NTR expression is significantly reduced, validating in vivo observations from previous studies .

  • Cytoskeleton-Associated Genes: Several genes involved in cytoskeletal organization show altered expression patterns:

    • Increased Expression: S100a4/Mts1 (tropomyosin and nonmuscle myosin II-binding protein)

    • Decreased Expression: RhoU (Cdc42-related protein) and Krt23 (intermediate filament protein)

  • Other Differentially Expressed Genes:

    • Increased Expression: Monooxygenase DBH-like 1 (Moxd1), secreted signaling protein Wnt16

    • Decreased Expression: Intracellular lipid receptor oxysterol-binding protein-like 3 (Osbpl3), water channel aquaporin 1 (Aqp1), and transcriptional cofactor LIM domain-binding 2 (Ldb2)

These expression changes occur despite normal expression levels of most transcription factors known to regulate Schwann cell differentiation and myelination, suggesting that MAL influences gene expression through other mechanisms beyond direct transcriptional regulation .

What signaling pathways are affected by MAL expression levels in Schwann cells?

Research on MAL-overexpressing Schwann cells has investigated the effects on major signaling pathways important for Schwann cell differentiation and myelination:

  • cAMP Response Element-Binding Protein (CREB) Pathway: MAL overexpression does not impair activation of the CREB signaling pathway. Upon forskolin treatment, MAL-overexpressing Schwann cells show comparable induction of Mpz expression as wild-type cells, indicating that the CREB pathway remains functional .

  • Phosphoinositide 3-Kinase (PI3K) Pathway: The delayed onset of myelination observed in vivo is not attributable to impaired phosphorylation of Akt, a key downstream effector of the PI3K pathway. Phosphorylation of Akt is induced in MAL-overexpressing Schwann cell cultures to a comparable degree as in wild-type cells .

  • Raf-ERK Pathway: Differential expression analysis of genes regulated by Raf-kinase activation revealed no transcriptional alterations in MAL-overexpressing Schwann cells, suggesting that the ERK pathway is not significantly affected by MAL overexpression .

These findings indicate that the effects of MAL overexpression on myelination are not primarily mediated through dysfunction of these major signaling pathways. Instead, MAL likely affects other cellular processes, such as membrane organization, protein trafficking, or cytoskeletal dynamics, which ultimately influence myelin formation.

How do changes in MAL expression correlate with alterations in cytoskeletal organization?

Research demonstrates significant correlations between MAL expression levels and cytoskeletal organization in myelin-forming cells:

  • S100a4 Regulation: MAL overexpression leads to increased expression of S100a4, a protein that:

    • Inhibits the assembly of nonmuscle myosin II monomers into filaments

    • Promotes the disassembly of myosin II filaments

    • Is implicated in remodeling the actin cytoskeleton

    Myosin II has been shown to be necessary for peripheral myelination, with its inhibition resulting in reduced myelin segments, decreased expression of myelin proteins, and impaired basal lamina assembly . Therefore, the increased S100a4 expression in MAL-overexpressing Schwann cells might enhance myosin II filament disassembly, affecting actin filament stability and potentially contributing to delayed myelination.

  • RhoU Expression and Localization: MAL overexpression reduces the expression of RhoU, a Cdc42-related protein that:

    • Localizes throughout the cytoplasm, within membrane protrusions, and along Schwann cell processes

    • Is detected within myelin sheaths but not in nonmyelinating Schwann cells in Remak bundles

  • Krt23 Expression and Localization: MAL overexpression decreases the expression of Krt23, which:

    • Shows punctated staining in the cytoplasm and membrane protrusions

    • Is detected within and along Schwann cell processes

    • Is present in both myelinating and nonmyelinating Schwann cells

These findings suggest that MAL influences both myelinating and nonmyelinating Schwann cells through the regulation of cytoskeletal components critical for proper cell morphology and membrane dynamics.

What experimental approaches can be used to study the effects of MAL mutations on myelin formation?

To investigate the effects of MAL mutations on myelin formation, researchers can employ several experimental approaches:

  • In vitro Myelination Models:

    • Schwann Cell-Neuron Co-cultures: Compare myelination efficiency between wild-type and mutant MAL-expressing Schwann cells when co-cultured with neurons.

    • Dose-Dependent Studies: Analyze the effects of varying levels of wild-type versus mutant MAL expression on myelin formation.

    • Time-Lapse Imaging: Monitor the dynamics of myelin formation in real-time to identify specific stages affected by MAL mutations.

  • Gene Expression Analysis:

    • Transcriptome Profiling: Compare gene expression patterns between wild-type and mutant MAL-expressing cells to identify differentially regulated genes, particularly those involved in myelin biogenesis and cytoskeletal organization.

    • qRT-PCR Validation: Confirm changes in expression of key myelin-related genes (e.g., Mpz, p75NTR) and cytoskeletal components (e.g., S100a4, RhoU, Krt23) .

  • Signaling Pathway Analysis:

    • Phosphorylation Studies: Assess the activation status of key signaling molecules (e.g., CREB, Akt) in response to differentiating stimuli like forskolin in cells expressing mutant MAL .

    • Pathway Inhibition Studies: Use specific inhibitors of signaling pathways to determine whether certain mutations sensitize or desensitize cells to pathway manipulation.

  • Cytoskeletal Analysis:

    • Immunofluorescence Microscopy: Visualize changes in cytoskeletal organization and cellular morphology resulting from MAL mutations.

    • Live Cell Imaging: Track cytoskeletal dynamics in real-time to identify specific alterations in cells expressing mutant MAL.

How can recombinant bovine MAL be utilized to study lipid raft dynamics in myelinating cells?

Recombinant bovine MAL can serve as a valuable tool for investigating lipid raft dynamics in myelinating cells through several methodological approaches:

  • Fluorescently Tagged MAL Proteins:

    • Generate recombinant bovine MAL fused with fluorescent proteins (e.g., GFP, mCherry)

    • Use live-cell imaging to track the movement and clustering of MAL-containing lipid rafts during different stages of Schwann cell differentiation and myelination

    • Employ FRAP (Fluorescence Recovery After Photobleaching) analysis to measure the mobility of MAL within membrane domains

  • Lipid Raft Isolation and Characterization:

    • Use recombinant MAL as a marker for isolating and purifying lipid rafts from myelinating cells

    • Compare the lipid and protein composition of rafts containing wild-type versus mutant MAL

    • Analyze how changes in MAL expression levels affect the distribution of other proteins between raft and non-raft membrane fractions

  • Protein-Lipid Interaction Studies:

    • Investigate how recombinant bovine MAL interacts with specific lipid species found in myelin membranes

    • Use biophysical techniques like surface plasmon resonance or monolayer insertion assays to quantify MAL-lipid interactions

    • Determine how these interactions influence membrane curvature and organization

  • In vitro Reconstitution Systems:

    • Incorporate purified recombinant bovine MAL into artificial membrane systems (liposomes, supported lipid bilayers)

    • Study how MAL influences membrane domain formation and protein sorting in controlled environments

    • Compare the membrane-organizing properties of wild-type and mutant forms of MAL

What are the methodological considerations for studying MAL protein-protein interactions?

When investigating MAL protein-protein interactions, researchers should consider several methodological approaches and technical challenges:

  • Membrane Protein Handling:

    • MAL is a membrane-associated proteolipid, requiring appropriate detergents or lipid environments for solubilization while maintaining native conformation

    • Selection of mild, non-denaturing detergents is critical for preserving physiologically relevant interactions

    • Consider native membrane environments (nanodiscs, liposomes) for maintaining the lipid raft context essential for MAL function

  • Interaction Detection Methods:

    • Co-immunoprecipitation: Use specific anti-MAL antibodies to pull down protein complexes under conditions that preserve membrane protein interactions

    • Proximity Labeling: Apply BioID or APEX techniques for in situ identification of proteins proximal to MAL in living cells

    • FRET-Based Approaches: Employ Förster Resonance Energy Transfer to detect direct protein-protein interactions in living cells

    • Crosslinking Mass Spectrometry: Identify interaction interfaces through chemical crosslinking followed by mass spectrometric analysis

  • Functional Validation Approaches:

    • Generate targeted mutations in potential interaction domains based on structural predictions

    • Assess the functional consequences of disrupting specific interactions on myelin formation

    • Correlate interaction strength with phenotypic outcomes in myelination assays

  • Cellular Context Considerations:

    • Compare interactions in different cell types relevant to MAL function (Schwann cells, oligodendrocytes, T-lymphocytes)

    • Analyze how interactions change during cell differentiation and myelination processes

    • Consider how lipid raft composition influences the interaction landscape of MAL

How should researchers interpret contradictory findings regarding MAL function across different experimental models?

When confronted with contradictory findings regarding MAL function across different experimental models, researchers should consider a systematic approach to data interpretation:

  • Model System Variables:

    • Compare species differences (bovine vs. rat vs. mouse MAL) that might explain functional variations

    • Evaluate cell type-specific effects (primary Schwann cells vs. cell lines vs. in vivo models)

    • Consider developmental timing differences between models

  • Expression Level Considerations:

    • Assess whether contradictions arise from differences in MAL expression levels

    • Research has shown that MAL overexpression impedes peripheral myelinogenesis, while complete absence may have different effects

    • Quantify MAL expression accurately across models using standardized methods

  • Experimental Condition Analysis:

    • Compare culture conditions, differentiation protocols, and stimulation parameters

    • In primary Schwann cells, forskolin treatment induces differentiation and affects MAL-dependent gene expression

    • Evaluate whether contradictions arise from differences in activation of signaling pathways

  • Technical Validation:

    • Confirm antibody specificity for detecting the appropriate MAL species variant

    • Validate key findings using multiple, complementary techniques

    • Consider statistical power and experimental replication

A structured analysis of these variables can help reconcile apparently contradictory findings and develop a more complete understanding of MAL biology across experimental contexts.

What statistical methods are most appropriate for analyzing MAL expression data in disease models?

Selection of appropriate statistical methods for analyzing MAL expression data depends on the experimental design and data characteristics:

  • For Comparing Expression Levels Between Groups:

    • Parametric Tests: Student's t-test (two groups) or ANOVA (multiple groups) for normally distributed data with equal variances

    • Non-parametric Alternatives: Mann-Whitney U test (two groups) or Kruskal-Wallis test (multiple groups) when normality assumptions are violated

    • Post-hoc Testing: Apply Tukey, Bonferroni, or Dunnett corrections for multiple comparisons

  • For Correlation Analysis:

    • Pearson Correlation: To assess linear relationships between MAL expression and continuous variables (e.g., myelin thickness, conduction velocity) when data are normally distributed

    • Spearman Rank Correlation: For non-parametric assessment of monotonic relationships

  • For Time Course Studies:

    • Repeated Measures ANOVA: To analyze changes in MAL expression over time within the same subjects

    • Mixed-Effects Models: To account for both fixed and random effects in longitudinal data

  • For Complex Datasets:

    • Multiple Regression Analysis: To identify factors independently associated with MAL expression

    • Principal Component Analysis: To reduce dimensionality in datasets with multiple correlated variables

    • Machine Learning Approaches: For identifying complex patterns in large datasets with multiple variables

  • For Gene Expression Studies:

    • Differential Expression Analysis: Methods such as DESeq2 or edgeR for RNA-seq data

    • Multiple Testing Correction: Apply Benjamini-Hochberg procedure to control false discovery rate when analyzing large numbers of genes

When reporting results, researchers should provide detailed statistical methods, include measures of variability (standard deviation, standard error), and report exact p-values rather than threshold-based significance.

What are common issues when working with recombinant MAL protein and how can they be addressed?

Researchers working with recombinant MAL protein may encounter several technical challenges that require specific troubleshooting approaches:

  • Low Expression Yields:

    • Issue: As a membrane protein, MAL often expresses poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use expression vectors with strong promoters specific for membrane proteins

      • Test multiple fusion tags to enhance solubility

      • Consider specialized expression systems designed for membrane proteins

  • Protein Aggregation:

    • Issue: MAL may aggregate during expression or purification

    • Solutions:

      • Express at lower temperatures (16-30°C depending on the system)

      • Screen multiple detergents for optimal solubilization

      • Add stabilizing agents such as glycerol or specific lipids

      • Consider on-column refolding protocols during purification

  • Loss of Functional Conformation:

    • Issue: Purified MAL may not retain its native conformation

    • Solutions:

      • Reconstitute purified MAL into lipid nanodiscs or liposomes

      • Maintain lipid raft components during purification

      • Validate protein folding using circular dichroism or other structural techniques

      • Perform functional assays to confirm biological activity

  • Non-specific Binding Issues:

    • Issue: High background in interaction studies or assays

    • Solutions:

      • Optimize washing conditions and blocking reagents

      • Use detergents that maintain specific interactions while reducing non-specific binding

      • Include competitors for non-specific interactions

      • Validate results with multiple complementary techniques

  • Batch-to-Batch Variability:

    • Issue: Inconsistent results between protein preparations

    • Solutions:

      • Standardize expression and purification protocols

      • Implement rigorous quality control measures

      • Pool multiple preparations for critical experiments

      • Include positive controls to normalize between batches

How can researchers optimize primary Schwann cell cultures for studying MAL function?

Optimization of primary Schwann cell cultures is critical for studying MAL function effectively. Research-based methodological considerations include:

  • Cell Isolation and Purity:

    • Isolate Schwann cells from sciatic nerves of newborn (P1) mice for optimal yield and viability

    • Implement purification steps to minimize fibroblast contamination

    • Verify culture purity using Schwann cell-specific markers

  • Culture Conditions:

    • Maintain cells in defined medium containing appropriate growth factors (e.g., neuregulin, forskolin)

    • Optimize cell density to promote survival while minimizing contact inhibition

    • Consider three-dimensional culture systems to better recapitulate the in vivo environment

  • Differentiation Protocols:

    • Use 20 μM forskolin treatment for 24 hours to activate the cAMP response element-binding protein (CREB) and induce expression of myelin-related genes

    • Monitor differentiation by measuring induction of myelin protein zero (Mpz/P0) expression

    • Allow sufficient time for differentiation before performing analytical assays

  • Genotypic Verification:

    • Confirm MAL expression levels by qRT-PCR to validate transgenic or knockout models

    • Verify that MAL overexpression persists in culture conditions similar to in vivo levels

    • Consider using internal controls for normalization when comparing genotypes

  • Analytical Considerations:

    • When studying MAL-dependent gene expression, collect samples from multiple independent cultures

    • For whole genome expression assays, analyze at least nine independent samples of untreated and forskolin-treated Schwann cells

    • Perform probe-specific analysis when using microarray approaches to identify MAL-dependent differentially expressed transcripts with high confidence

What are promising research avenues for understanding MAL function in demyelinating disorders?

Several promising research directions could advance our understanding of MAL function in demyelinating disorders:

  • Therapeutic Target Exploration:

    • Investigate whether modulating MAL expression or function can enhance remyelination in disease models

    • Develop small molecule or peptide-based approaches to normalize MAL-dependent processes

    • Explore gene therapy approaches to correct MAL expression in affected tissues

  • Cytoskeletal Regulation Mechanisms:

    • Further characterize how MAL regulates cytoskeletal proteins like S100a4, RhoU, and Krt23

    • Investigate whether targeting these downstream effectors can bypass MAL dysfunction

    • Develop high-resolution imaging approaches to visualize MAL-dependent cytoskeletal changes during demyelination and remyelination

  • Membrane Domain Organization:

    • Elucidate how MAL organizes specialized membrane domains required for myelination

    • Investigate whether MAL dysfunction disrupts specific lipid-protein interactions critical for myelin stability

    • Develop tools to visualize and manipulate MAL-dependent membrane domains in living cells

  • Cell-Type Specific Functions:

    • Compare MAL function between different myelin-forming cell types (Schwann cells vs. oligodendrocytes)

    • Investigate cell-autonomous versus non-cell-autonomous effects of MAL dysregulation

    • Develop conditional knockout or expression systems to manipulate MAL in specific cell populations

  • Translational Applications:

    • Evaluate MAL as a biomarker for disease progression or treatment response

    • Develop high-throughput screening assays to identify compounds that normalize MAL function

    • Investigate whether MAL expression patterns correlate with remyelination capacity in human tissue samples

How might CRISPR/Cas9 gene editing approaches be utilized to study MAL biology?

CRISPR/Cas9 gene editing technologies offer powerful approaches for investigating MAL biology:

  • Precise Genetic Modifications:

    • Generate knock-in models with fluorescently tagged MAL to track its localization and dynamics

    • Create point mutations to identify critical functional domains and residues

    • Develop conditional alleles to control MAL expression temporally and spatially

  • Functional Genomic Screening:

    • Perform genome-wide CRISPR screens to identify genes that modify MAL-dependent phenotypes

    • Target transcription factors that regulate MAL expression

    • Identify suppressors and enhancers of MAL overexpression phenotypes

  • Humanized Models:

    • Replace endogenous animal MAL genes with human variants to better model human diseases

    • Introduce human disease-associated MAL variants to study their functional consequences

    • Create isogenic cell lines differing only in MAL sequence to isolate variant-specific effects

  • Cellular Models:

    • Generate MAL knockout cell lines as platforms for structure-function studies

    • Create reporter cell lines where endogenous MAL activity controls expression of fluorescent or luminescent proteins

    • Develop high-throughput cellular models for drug screening

  • In Vivo Applications:

    • Deliver CRISPR components to specific cell types in the nervous system to modify MAL expression

    • Create mosaic animals with MAL modifications in subsets of cells to study cell-autonomous effects

    • Develop rapid approaches to test hypotheses about MAL function without generating germline-modified animals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.