Recombinant Bovine MAL (UniProt ID: Q3ZBY0) is a 17-kDa hydrophobic integral membrane protein with four transmembrane domains. It consists of 153 amino acids, including the sequence:
MAPSAASGVSSLPSGFAVFTTFPDLLFIFEFVFGGLVWILVSSSHVPIPLIQGWVMFASV FCFVATTVLAFLYVIGAHGNRTSWITLDAAYHCVASLFYFGASVLEALAAIQLQDGFLYK YYHENISAVVFSYVATLLYVVHAVFSLIRWKSS .
| Property | Value |
|---|---|
| Molecular Weight | 16,784 Da |
| Subcellular Localization | Membrane (Multi-pass) |
| Expression System | E. coli with N-terminal His tag |
| Purity | >90% (SDS-PAGE verified) |
MAL is critical for:
Vesicular Trafficking: Directs apical transport of proteins in polarized epithelial cells and stabilizes lipid rafts .
Myelin Biogenesis: Facilitates sorting of myelin proteolipid protein (PLP) and neurofascin 155 in oligodendrocytes and Schwann cells .
Immune Signaling: Regulates T-cell receptor (TCR) signaling by transporting Src-like kinases (e.g., Lck) to lipid rafts .
In bovine models, MAL deficiency disrupts GPI-anchored protein trafficking, while overexpression alters Schwann cell differentiation and reduces myelin protein zero (Mpz) expression .
Recombinant Bovine MAL is produced via E. coli expression systems, followed by affinity chromatography for His-tag purification . Key quality control metrics include:
| Parameter | Specification |
|---|---|
| Storage Buffer | Tris/PBS, 6% Trehalose (pH 8.0) |
| Reconstitution | 0.1–1.0 mg/mL in sterile water |
| Stability | Stable at -80°C; avoid freeze-thaw |
| Applications | ELISA, Western blot, cell assays |
MAL overexpression reduces Mpz and p75NTR expression in primary mouse Schwann cells, delaying myelination .
Alters cytoskeletal dynamics via RhoU and Krt23 downregulation, affecting membrane protrusion formation .
MAL is overexpressed in ovarian cancer and lymphomas, promoting tumor progression .
Conversely, MAL silencing impairs exosome secretion in T-cells, suggesting context-dependent roles in cancer .
Myelin and Lymphocyte protein (MAL) is a 17 kDa proteolipid that functions as a key component in lipid rafts, specialized membrane microdomains rich in cholesterol and sphingolipids. MAL plays crucial roles in both the nervous system and immune cells. In myelin-forming cells, MAL is involved in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane . Research indicates that MAL is important for targeting proteins and lipids to distinct domains and is considered a critical component in myelin biogenesis and/or myelin function . The proper expression and function of MAL are essential for normal myelination processes, particularly in the peripheral nervous system where it participates in the coordinated reciprocal signaling between Schwann cells and axons necessary for accurate myelination .
MAL expression is tightly regulated during Schwann cell development and myelination. Studies have shown that MAL overexpression impedes peripheral myelinogenesis, causing a delayed onset of myelination and reduced expression of the myelin protein zero (Mpz/P0) and the low-affinity neurotrophin receptor p75NTR . This effect occurs early in Schwann cell development, as reduced expression of Mpz and p75NTR is evident even before differentiation in primary mouse Schwann cell cultures overexpressing MAL . This suggests that MAL plays a regulatory role in early Schwann cell development that ultimately influences myelination processes.
The effects of MAL overexpression on gene expression are not mediated through alterations in major transcription factors, as most transcription factors known to regulate Schwann cell differentiation and myelination (except for a small reduction in Sox10) remain largely unchanged in MAL-overexpressing Schwann cells .
Several methodological approaches are commonly employed to detect and quantify MAL protein in research settings:
Enzyme-Linked Immunosorbent Assay (ELISA): Sandwich ELISA kits specifically designed for MAL detection provide precise measurements of MAL protein levels in various sample types including serum, plasma, tissue homogenates, and cell culture supernatants . These assays typically offer:
Detection ranges of 0.312-20 ng/mL
Sensitivity levels of approximately 0.156 ng/mL
Compatibility with multiple sample types
Immunofluorescence Microscopy: This technique enables visualization of MAL localization within cells and tissues. Studies have used this approach to determine the subcellular distribution of MAL and MAL-regulated proteins in Schwann cells, revealing localization patterns in cytoplasm, membrane protrusions, and cellular processes .
Quantitative Real-Time PCR (qRT-PCR): For analysis of MAL expression at the transcriptional level, qRT-PCR provides quantitative measurements of mRNA levels. This approach has been used to detect the significant overexpression of Mal mRNA in both treated and untreated conditions in Schwann cells derived from MAL-overexpressing mice .
Whole Genome Expression Assays: For comprehensive analysis of MAL-dependent gene expression changes, microarray analyses covering more than 45,000 transcripts have been employed to identify differentially expressed genes in MAL-overexpressing cells compared to wild-type controls .
Bovine MAL protein shares structural and functional similarities with MAL proteins from other mammalian species, though with species-specific variations that may influence its precise biological activity. When designing experiments with recombinant bovine MAL, researchers should consider these cross-species similarities and differences.
The MAL protein is known by several synonyms across species, including:
Structurally, MAL proteins generally contain multiple transmembrane domains that facilitate their association with lipid rafts. While the search results don't provide detailed structural information specific to bovine MAL, research approaches to investigate species-specific differences typically include sequence homology analysis, functional complementation studies, and comparative analysis of interaction networks.
Production of functional recombinant bovine MAL requires careful consideration of expression systems and purification strategies due to its nature as a membrane-associated proteolipid. While specific protocols for bovine MAL are not detailed in the search results, methodological considerations should include:
Expression System Selection: For proper folding and post-translational modifications, eukaryotic expression systems (mammalian, insect, or yeast cells) are generally preferred over bacterial systems for membrane proteins like MAL.
Solubilization Strategy: As a membrane protein, MAL requires appropriate detergents or lipid environments for solubilization while maintaining native conformation.
Purification Approach: Affinity chromatography techniques using epitope tags (His-tag, GST-tag) facilitate isolation of the recombinant protein while minimizing native protein contamination.
Quality Control: Verification of protein identity, purity, and functionality through techniques such as mass spectrometry, circular dichroism, and functional assays is essential for ensuring research-grade quality.
MAL overexpression induces significant changes in gene expression patterns in Schwann cells, particularly affecting genes involved in myelination and cytoskeletal organization. Whole genome expression analysis of primary mouse Schwann cells has revealed:
Myelin-Related Genes: MAL overexpression leads to approximately 50% reduction in Mpz mRNA expression under both unstimulated (p < 0.0001) and forskolin-stimulated (p < 0.007) conditions . Similarly, p75NTR expression is significantly reduced, validating in vivo observations from previous studies .
Cytoskeleton-Associated Genes: Several genes involved in cytoskeletal organization show altered expression patterns:
Increased Expression: S100a4/Mts1 (tropomyosin and nonmuscle myosin II-binding protein)
Decreased Expression: RhoU (Cdc42-related protein) and Krt23 (intermediate filament protein)
Other Differentially Expressed Genes:
Increased Expression: Monooxygenase DBH-like 1 (Moxd1), secreted signaling protein Wnt16
Decreased Expression: Intracellular lipid receptor oxysterol-binding protein-like 3 (Osbpl3), water channel aquaporin 1 (Aqp1), and transcriptional cofactor LIM domain-binding 2 (Ldb2)
These expression changes occur despite normal expression levels of most transcription factors known to regulate Schwann cell differentiation and myelination, suggesting that MAL influences gene expression through other mechanisms beyond direct transcriptional regulation .
Research on MAL-overexpressing Schwann cells has investigated the effects on major signaling pathways important for Schwann cell differentiation and myelination:
cAMP Response Element-Binding Protein (CREB) Pathway: MAL overexpression does not impair activation of the CREB signaling pathway. Upon forskolin treatment, MAL-overexpressing Schwann cells show comparable induction of Mpz expression as wild-type cells, indicating that the CREB pathway remains functional .
Phosphoinositide 3-Kinase (PI3K) Pathway: The delayed onset of myelination observed in vivo is not attributable to impaired phosphorylation of Akt, a key downstream effector of the PI3K pathway. Phosphorylation of Akt is induced in MAL-overexpressing Schwann cell cultures to a comparable degree as in wild-type cells .
Raf-ERK Pathway: Differential expression analysis of genes regulated by Raf-kinase activation revealed no transcriptional alterations in MAL-overexpressing Schwann cells, suggesting that the ERK pathway is not significantly affected by MAL overexpression .
These findings indicate that the effects of MAL overexpression on myelination are not primarily mediated through dysfunction of these major signaling pathways. Instead, MAL likely affects other cellular processes, such as membrane organization, protein trafficking, or cytoskeletal dynamics, which ultimately influence myelin formation.
Research demonstrates significant correlations between MAL expression levels and cytoskeletal organization in myelin-forming cells:
S100a4 Regulation: MAL overexpression leads to increased expression of S100a4, a protein that:
Inhibits the assembly of nonmuscle myosin II monomers into filaments
Promotes the disassembly of myosin II filaments
Myosin II has been shown to be necessary for peripheral myelination, with its inhibition resulting in reduced myelin segments, decreased expression of myelin proteins, and impaired basal lamina assembly . Therefore, the increased S100a4 expression in MAL-overexpressing Schwann cells might enhance myosin II filament disassembly, affecting actin filament stability and potentially contributing to delayed myelination.
RhoU Expression and Localization: MAL overexpression reduces the expression of RhoU, a Cdc42-related protein that:
Krt23 Expression and Localization: MAL overexpression decreases the expression of Krt23, which:
These findings suggest that MAL influences both myelinating and nonmyelinating Schwann cells through the regulation of cytoskeletal components critical for proper cell morphology and membrane dynamics.
To investigate the effects of MAL mutations on myelin formation, researchers can employ several experimental approaches:
In vitro Myelination Models:
Schwann Cell-Neuron Co-cultures: Compare myelination efficiency between wild-type and mutant MAL-expressing Schwann cells when co-cultured with neurons.
Dose-Dependent Studies: Analyze the effects of varying levels of wild-type versus mutant MAL expression on myelin formation.
Time-Lapse Imaging: Monitor the dynamics of myelin formation in real-time to identify specific stages affected by MAL mutations.
Gene Expression Analysis:
Transcriptome Profiling: Compare gene expression patterns between wild-type and mutant MAL-expressing cells to identify differentially regulated genes, particularly those involved in myelin biogenesis and cytoskeletal organization.
qRT-PCR Validation: Confirm changes in expression of key myelin-related genes (e.g., Mpz, p75NTR) and cytoskeletal components (e.g., S100a4, RhoU, Krt23) .
Signaling Pathway Analysis:
Phosphorylation Studies: Assess the activation status of key signaling molecules (e.g., CREB, Akt) in response to differentiating stimuli like forskolin in cells expressing mutant MAL .
Pathway Inhibition Studies: Use specific inhibitors of signaling pathways to determine whether certain mutations sensitize or desensitize cells to pathway manipulation.
Cytoskeletal Analysis:
Immunofluorescence Microscopy: Visualize changes in cytoskeletal organization and cellular morphology resulting from MAL mutations.
Live Cell Imaging: Track cytoskeletal dynamics in real-time to identify specific alterations in cells expressing mutant MAL.
Recombinant bovine MAL can serve as a valuable tool for investigating lipid raft dynamics in myelinating cells through several methodological approaches:
Fluorescently Tagged MAL Proteins:
Generate recombinant bovine MAL fused with fluorescent proteins (e.g., GFP, mCherry)
Use live-cell imaging to track the movement and clustering of MAL-containing lipid rafts during different stages of Schwann cell differentiation and myelination
Employ FRAP (Fluorescence Recovery After Photobleaching) analysis to measure the mobility of MAL within membrane domains
Lipid Raft Isolation and Characterization:
Use recombinant MAL as a marker for isolating and purifying lipid rafts from myelinating cells
Compare the lipid and protein composition of rafts containing wild-type versus mutant MAL
Analyze how changes in MAL expression levels affect the distribution of other proteins between raft and non-raft membrane fractions
Protein-Lipid Interaction Studies:
Investigate how recombinant bovine MAL interacts with specific lipid species found in myelin membranes
Use biophysical techniques like surface plasmon resonance or monolayer insertion assays to quantify MAL-lipid interactions
Determine how these interactions influence membrane curvature and organization
In vitro Reconstitution Systems:
Incorporate purified recombinant bovine MAL into artificial membrane systems (liposomes, supported lipid bilayers)
Study how MAL influences membrane domain formation and protein sorting in controlled environments
Compare the membrane-organizing properties of wild-type and mutant forms of MAL
When investigating MAL protein-protein interactions, researchers should consider several methodological approaches and technical challenges:
Membrane Protein Handling:
MAL is a membrane-associated proteolipid, requiring appropriate detergents or lipid environments for solubilization while maintaining native conformation
Selection of mild, non-denaturing detergents is critical for preserving physiologically relevant interactions
Consider native membrane environments (nanodiscs, liposomes) for maintaining the lipid raft context essential for MAL function
Interaction Detection Methods:
Co-immunoprecipitation: Use specific anti-MAL antibodies to pull down protein complexes under conditions that preserve membrane protein interactions
Proximity Labeling: Apply BioID or APEX techniques for in situ identification of proteins proximal to MAL in living cells
FRET-Based Approaches: Employ Förster Resonance Energy Transfer to detect direct protein-protein interactions in living cells
Crosslinking Mass Spectrometry: Identify interaction interfaces through chemical crosslinking followed by mass spectrometric analysis
Functional Validation Approaches:
Generate targeted mutations in potential interaction domains based on structural predictions
Assess the functional consequences of disrupting specific interactions on myelin formation
Correlate interaction strength with phenotypic outcomes in myelination assays
Cellular Context Considerations:
Compare interactions in different cell types relevant to MAL function (Schwann cells, oligodendrocytes, T-lymphocytes)
Analyze how interactions change during cell differentiation and myelination processes
Consider how lipid raft composition influences the interaction landscape of MAL
When confronted with contradictory findings regarding MAL function across different experimental models, researchers should consider a systematic approach to data interpretation:
Model System Variables:
Compare species differences (bovine vs. rat vs. mouse MAL) that might explain functional variations
Evaluate cell type-specific effects (primary Schwann cells vs. cell lines vs. in vivo models)
Consider developmental timing differences between models
Expression Level Considerations:
Experimental Condition Analysis:
Technical Validation:
Confirm antibody specificity for detecting the appropriate MAL species variant
Validate key findings using multiple, complementary techniques
Consider statistical power and experimental replication
A structured analysis of these variables can help reconcile apparently contradictory findings and develop a more complete understanding of MAL biology across experimental contexts.
Selection of appropriate statistical methods for analyzing MAL expression data depends on the experimental design and data characteristics:
For Comparing Expression Levels Between Groups:
Parametric Tests: Student's t-test (two groups) or ANOVA (multiple groups) for normally distributed data with equal variances
Non-parametric Alternatives: Mann-Whitney U test (two groups) or Kruskal-Wallis test (multiple groups) when normality assumptions are violated
Post-hoc Testing: Apply Tukey, Bonferroni, or Dunnett corrections for multiple comparisons
For Correlation Analysis:
Pearson Correlation: To assess linear relationships between MAL expression and continuous variables (e.g., myelin thickness, conduction velocity) when data are normally distributed
Spearman Rank Correlation: For non-parametric assessment of monotonic relationships
For Time Course Studies:
Repeated Measures ANOVA: To analyze changes in MAL expression over time within the same subjects
Mixed-Effects Models: To account for both fixed and random effects in longitudinal data
For Complex Datasets:
Multiple Regression Analysis: To identify factors independently associated with MAL expression
Principal Component Analysis: To reduce dimensionality in datasets with multiple correlated variables
Machine Learning Approaches: For identifying complex patterns in large datasets with multiple variables
For Gene Expression Studies:
Differential Expression Analysis: Methods such as DESeq2 or edgeR for RNA-seq data
Multiple Testing Correction: Apply Benjamini-Hochberg procedure to control false discovery rate when analyzing large numbers of genes
When reporting results, researchers should provide detailed statistical methods, include measures of variability (standard deviation, standard error), and report exact p-values rather than threshold-based significance.
Researchers working with recombinant MAL protein may encounter several technical challenges that require specific troubleshooting approaches:
Low Expression Yields:
Issue: As a membrane protein, MAL often expresses poorly in heterologous systems
Solutions:
Optimize codon usage for the expression host
Use expression vectors with strong promoters specific for membrane proteins
Test multiple fusion tags to enhance solubility
Consider specialized expression systems designed for membrane proteins
Protein Aggregation:
Issue: MAL may aggregate during expression or purification
Solutions:
Express at lower temperatures (16-30°C depending on the system)
Screen multiple detergents for optimal solubilization
Add stabilizing agents such as glycerol or specific lipids
Consider on-column refolding protocols during purification
Loss of Functional Conformation:
Issue: Purified MAL may not retain its native conformation
Solutions:
Reconstitute purified MAL into lipid nanodiscs or liposomes
Maintain lipid raft components during purification
Validate protein folding using circular dichroism or other structural techniques
Perform functional assays to confirm biological activity
Non-specific Binding Issues:
Issue: High background in interaction studies or assays
Solutions:
Optimize washing conditions and blocking reagents
Use detergents that maintain specific interactions while reducing non-specific binding
Include competitors for non-specific interactions
Validate results with multiple complementary techniques
Batch-to-Batch Variability:
Issue: Inconsistent results between protein preparations
Solutions:
Standardize expression and purification protocols
Implement rigorous quality control measures
Pool multiple preparations for critical experiments
Include positive controls to normalize between batches
Optimization of primary Schwann cell cultures is critical for studying MAL function effectively. Research-based methodological considerations include:
Cell Isolation and Purity:
Culture Conditions:
Maintain cells in defined medium containing appropriate growth factors (e.g., neuregulin, forskolin)
Optimize cell density to promote survival while minimizing contact inhibition
Consider three-dimensional culture systems to better recapitulate the in vivo environment
Differentiation Protocols:
Use 20 μM forskolin treatment for 24 hours to activate the cAMP response element-binding protein (CREB) and induce expression of myelin-related genes
Monitor differentiation by measuring induction of myelin protein zero (Mpz/P0) expression
Allow sufficient time for differentiation before performing analytical assays
Genotypic Verification:
Analytical Considerations:
When studying MAL-dependent gene expression, collect samples from multiple independent cultures
For whole genome expression assays, analyze at least nine independent samples of untreated and forskolin-treated Schwann cells
Perform probe-specific analysis when using microarray approaches to identify MAL-dependent differentially expressed transcripts with high confidence
Several promising research directions could advance our understanding of MAL function in demyelinating disorders:
Therapeutic Target Exploration:
Investigate whether modulating MAL expression or function can enhance remyelination in disease models
Develop small molecule or peptide-based approaches to normalize MAL-dependent processes
Explore gene therapy approaches to correct MAL expression in affected tissues
Cytoskeletal Regulation Mechanisms:
Further characterize how MAL regulates cytoskeletal proteins like S100a4, RhoU, and Krt23
Investigate whether targeting these downstream effectors can bypass MAL dysfunction
Develop high-resolution imaging approaches to visualize MAL-dependent cytoskeletal changes during demyelination and remyelination
Membrane Domain Organization:
Elucidate how MAL organizes specialized membrane domains required for myelination
Investigate whether MAL dysfunction disrupts specific lipid-protein interactions critical for myelin stability
Develop tools to visualize and manipulate MAL-dependent membrane domains in living cells
Cell-Type Specific Functions:
Compare MAL function between different myelin-forming cell types (Schwann cells vs. oligodendrocytes)
Investigate cell-autonomous versus non-cell-autonomous effects of MAL dysregulation
Develop conditional knockout or expression systems to manipulate MAL in specific cell populations
Translational Applications:
Evaluate MAL as a biomarker for disease progression or treatment response
Develop high-throughput screening assays to identify compounds that normalize MAL function
Investigate whether MAL expression patterns correlate with remyelination capacity in human tissue samples
CRISPR/Cas9 gene editing technologies offer powerful approaches for investigating MAL biology:
Precise Genetic Modifications:
Generate knock-in models with fluorescently tagged MAL to track its localization and dynamics
Create point mutations to identify critical functional domains and residues
Develop conditional alleles to control MAL expression temporally and spatially
Functional Genomic Screening:
Perform genome-wide CRISPR screens to identify genes that modify MAL-dependent phenotypes
Target transcription factors that regulate MAL expression
Identify suppressors and enhancers of MAL overexpression phenotypes
Humanized Models:
Replace endogenous animal MAL genes with human variants to better model human diseases
Introduce human disease-associated MAL variants to study their functional consequences
Create isogenic cell lines differing only in MAL sequence to isolate variant-specific effects
Cellular Models:
Generate MAL knockout cell lines as platforms for structure-function studies
Create reporter cell lines where endogenous MAL activity controls expression of fluorescent or luminescent proteins
Develop high-throughput cellular models for drug screening
In Vivo Applications:
Deliver CRISPR components to specific cell types in the nervous system to modify MAL expression
Create mosaic animals with MAL modifications in subsets of cells to study cell-autonomous effects
Develop rapid approaches to test hypotheses about MAL function without generating germline-modified animals