Recombinant Bovine Myelin-oligodendrocyte glycoprotein (MOG)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Bovine Myelin-oligodendrocyte glycoprotein (MOG) is a protein produced through recombinant DNA technology, utilizing bovine MOG gene sequences. MOG itself is a glycoprotein found on the surface of oligodendrocytes, the cells responsible for myelinating nerve fibers in the central nervous system (CNS) . As such, MOG is a target in autoimmune demyelinating diseases, including multiple sclerosis (MS) and MOG antibody-associated disease (MOGAD) .

Characteristics

CharacteristicsDescription
SourceE. coli
SpeciesBovine
Fragment29-246 aa
SequenceGQFRVIGPGHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDEE QAPEYRGRTQLLKETIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WINPGVLVLIAVLPVLLLQITVGLVFLCLQRRLRGKLWAEIENLHRTFDPHFLMVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
TagHis-tag or Tag free
Purity>90%, determined by SDS-PAGE
ConjugationUnconjugated
TargetMOG
Full NameMyelin-oligodendrocyte glycoprotein
Uniprot IDP55803
BackgroundMinor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication .
Alternate NamesMyelin-oligodendrocyte glycoprotein
Biological ActivityDetermined by its binding ability in a functional ELISA
ApplicationELISA, WB, and IP

Research Applications

  1. MOG-specific antibody studies Immunization of C57BL/6 mice with recombinant human MOG (hMOG) results in experimental autoimmune encephalomyelitis involving MOG-specific, demyelinating Abs .

  2. Diagnostic technique Recombinant MOG is used in live cell-based assays for the detection of MOG-IgG in clinical samples .

  3. T cell stimulation Bead-coupled recombinant MOG is used for stimulation of T cells in MS patients .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOG; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-246
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
MOG
Target Protein Sequence
GQFRVIGPGHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDEE QAPEYRGRTQLLKETIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WINPGVLVLIAVLPVLLLQITVGLVFLCLQRRLRGKLWAEIENLHRTFDPHFLMVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function

Recombinant Bovine Myelin-oligodendrocyte glycoprotein (MOG) mediates homophilic cell-cell adhesion. It is a minor component of the myelin sheath and may be involved in myelin sheath formation and maintenance, as well as cell-cell communication.

Database Links
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Q&A

What is Myelin-oligodendrocyte glycoprotein (MOG) and why is it significant in neuroscience research?

MOG is a Type 1 integral membrane glycoprotein of 26-28 kDa found exclusively in mammals and highly conserved between species. It is expressed in the outermost layer of myelin in the central nervous system (CNS) . MOG is significant in neuroscience research because:

  • It is a minor component of myelin that plays a role in myelin sheath maintenance and cell-cell communication

  • It serves as a key CNS-specific autoantigen in demyelinating diseases like multiple sclerosis (MS)

  • It is frequently used to induce experimental autoimmune encephalomyelitis (EAE), an animal model for MS

Despite intensive research, MOG's precise biological function remains to be fully determined. Postulated roles include acting as an adhesion molecule, a compactor of myelin, a stabilizer of microtubules, and interaction with components like C1q, nerve growth factor, and certain cellular receptors .

How does bovine MOG differ from human MOG in terms of structure and immunogenicity?

Bovine MOG shares high sequence conservation with human MOG, making it valuable for comparative studies. Key differences include:

  • Specific epitope variations that can affect antibody recognition across species

  • Differential binding patterns observed in cross-reactivity studies

  • When used in experimental settings, bovine MOG can induce antibodies that may cross-react with human MOG

As demonstrated in surface plasmon resonance (SPR) studies, antibodies produced against human MOG may have different binding affinities for bovine MOG, with some antibodies showing species-specific recognition while others exhibit cross-reactivity . This has important implications for understanding the antigenic determinants of MOG and their role in autoimmune responses.

What expression systems are preferred for producing recombinant bovine MOG, and how does the expression system affect protein quality?

The most common expression systems for recombinant bovine MOG production include:

  • Prokaryotic expression (E. coli):

    • Advantages: High yield, cost-effective, simpler production process

    • Limitations: Lacks post-translational modifications (PTMs), potential misfolding

    • Often used for producing the extracellular domain (typically residues 29-153)

  • Mammalian cell expression systems:

    • Advantages: Proper protein folding, appropriate PTMs

    • Used for studies requiring native-like conformations of MOG

    • Example: HEK293 cells with transfection efficiency of approximately 21%

For functional studies where proper folding is critical, mammalian expression systems are preferred despite lower yields. For structural studies or applications where high protein quantity is needed and PTMs are less critical, prokaryotic systems like E. coli are commonly used .

What validation methods should be used to confirm the identity and activity of recombinant bovine MOG?

A comprehensive validation approach for recombinant bovine MOG should include:

  • Biochemical validation:

    • SDS-PAGE to confirm molecular weight (~18 kDa for the extracellular domain)

    • Western blotting using MOG-specific antibodies (e.g., 8-18C5)

    • Mass spectrometry to verify amino acid sequence and modifications

  • Structural validation:

    • Circular dichroism to assess secondary structure

    • Surface plasmon resonance (SPR) to evaluate binding to anti-MOG antibodies

  • Functional validation:

    • Binding studies with known MOG-specific antibodies

    • Bioactivity assessment in cell-based assays

    • EAE induction capacity in animal models

  • Stability assessment:

    • Thermal stability through accelerated degradation tests

    • Freeze-thaw stability testing

    • Long-term storage assessment at different temperatures

For example, SPR analyses have been used to determine the binding affinities of MOG-specific monoclonal antibodies to recombinant MOG, with reported affinities ranging from 0.7 nM to 38 nM for human MOG, and 0.9 nM to 301 nM for mouse MOG .

How do different MOG peptides and recombinant proteins compare in their ability to induce EAE in animal models?

Different MOG preparations vary in their encephalitogenic potential:

MOG FormSpeciesOptimal DosageEAE FeaturesReference
MOG35-55 peptideMouse100-200 μgChronic progressive EAE in C57BL/6 mice
Recombinant human MOG (rhMOG)Human100-200 μgSevere chronic EAE in HLA-DR2+ transgenic mice
Bovine MOGBovine100-300 μgDemyelinating pathology with antibody involvement

The choice of MOG preparation significantly affects the EAE manifestation:

  • MOG peptides (especially MOG35-55) typically induce T-cell-mediated EAE in C57BL/6 mice

  • Full-length recombinant MOG tends to activate both T and B cell responses, resulting in more severe demyelination

  • Species origin matters—human MOG can induce antibodies that recognize native MOG on the cell surface, while mouse MOG immunization often results in antibodies that poorly recognize native MOG

How can recombinant MOG be used to develop therapeutic approaches for demyelinating diseases?

Recombinant MOG has been instrumental in developing several therapeutic approaches:

  • Recombinant TCR Ligands (RTLs):

    • RTLs combining MOG peptides with MHC molecules can induce tolerance to the antigen

    • Example: MOG/DR2 VG312 RTL (combining α1 and β1 domains of DR2 with MOG35-55) induced long-term tolerance and reversed clinical signs of EAE in transgenic mice

    • Mechanism involves reduced secretion of Th1 cytokines (TNF-α and IFN-γ)

  • Nanoparticle-based delivery systems:

    • Similar to approaches used with MBP, MOG can be formulated into nanoparticles for controlled release

    • Poly(ε-caprolactone) nanoparticles have shown promise for delivery of hydrophilic proteins across the blood-brain barrier

    • Benefits include preserved protein stability, controlled release patterns, and enhanced bioavailability

  • Antigen-specific tolerance induction:

    • Administration of MOG in specific formulations or routes can induce immune tolerance

    • This approach has shown promise in reducing disease severity in EAE models

Research has demonstrated that these approaches can significantly reduce inflammatory cytokine production, minimize histological damage, and preserve myelin sheaths in EAE models .

What are the most reliable methods for detecting MOG-specific antibodies in research and clinical samples?

Several methods have been developed for MOG antibody detection, with cell-based assays (CBAs) being the gold standard:

  • Cell-Based Assays with Flow Cytometry (CBA-FC):

    • Sensitivity: 84.4-95.6% (depending on protocol)

    • Specificity: 91.5-98.3%

    • Advantages: High throughput, objective quantification

    • Sample dilutions: 1:20 for standard, 1:100-1:640 for high specificity

  • Cell-Based Assays with Immunofluorescence (CBA-IF):

    • Considered the reference standard

    • Better for visualization of binding patterns

    • More labor-intensive and subjective than CBA-FC

  • ELISA with Recombinant MOG:

    • Less sensitive for conformational epitopes

    • Useful for high-throughput screening

    • Often used for cross-reactivity studies

  • MOG Tetramer Technology:

    • Uses fluorescently labeled MOG tetramers

    • Specific for detecting MOG-reactive B cells

    • Example: Biotinylated MOG monomers tetramerized with fluorophore-conjugated streptavidin have been validated to label at least 70% of MOG-specific B cells

For optimal results, cutoff values should be established using the formula [X+(4×SD)], where X is the mean fluorescence intensity of negative controls. For CBA-FC using a 1:20 dilution, a typical cutoff is around 377.40 for ΔMFI or 1.97 for rMFI .

How do MOG-specific antibodies differ in their epitope recognition and pathogenic potential?

MOG-specific antibodies show considerable heterogeneity in their epitope recognition and pathogenic capacity:

  • Epitope recognition patterns:

    • Some antibodies target the FG loop (e.g., 8-18C5 mAb), particularly residues 103-104

    • Others recognize different regions, including conformational epitopes

    • A study of MOG-specific mAbs from C57BL/6 mice identified at least four distinct epitopes with different pathogenic potential

  • Binding affinities:

    • Affinity for human MOG ranges from 0.7-38 nM

    • Affinity for mouse MOG ranges from 0.9-301 nM

    • High-affinity antibodies (Kd < 5 nM) tend to show stronger pathogenicity

  • Pathogenic mechanisms:

    • Complement-dependent cytotoxicity

    • Antibody-dependent cellular cytotoxicity

    • Disruption of oligodendrocyte function without cell death

    • Enhancement of T-cell mediated inflammation

  • Cross-species reactivity:

    • Some antibodies show species-specific recognition

    • Others demonstrate cross-reactivity between human, mouse, and bovine MOG

    • This has implications for translational research and model selection

The table below shows representative monoclonal antibodies and their binding characteristics:

mAbIsotypehMOG Kd (nM)mMOG Kd (nM)mMOG-DM Kd (nM)Pathogenic Potential
1009IgG2b1.41.01.5High
1010IgG11.00.90.5High
1023IgG10.71.01.2High
1005IgG2b38.0301.0321.0Moderate
8-18C5IgG110.618.6NDHigh

ND: Not determined due to very low affinity .

How do post-translational modifications of recombinant bovine MOG affect its immunogenicity and research applications?

Post-translational modifications (PTMs) significantly impact recombinant MOG properties:

  • Glycosylation:

    • MOG contains a conserved N-glycosylation site (N31) in its extracellular domain

    • E. coli-expressed MOG lacks glycosylation, potentially affecting conformational epitopes

    • Mammalian cell-expressed MOG contains proper glycosylation, making it more suitable for studies of conformational antibodies

    • Differential glycosylation can alter immunogenicity and antigenicity

  • Disulfide bonds:

    • The MOG extracellular domain contains a disulfide bond critical for proper folding

    • Improper formation in bacterial systems may lead to misfolded protein

    • Correct disulfide bond formation is essential for recognition by conformation-dependent antibodies

  • Impact on research applications:

    • For structural studies: Bacterial expression may be sufficient

    • For functional studies: Mammalian expression systems are preferred

    • For antibody epitope mapping: Both forms provide complementary information

    • For EAE induction: Both forms are effective but may induce different disease phenotypes

Research has shown that differences in PTMs between recombinant and native MOG can lead to differential antigenicity, suggesting potential applications for modified recombinant MOG as therapeutic vaccines .

What is the current understanding of cross-reactivity between bovine MOG and other antigens, and what are its implications for autoimmunity research?

Cross-reactivity between MOG and other antigens has important implications for autoimmunity research:

  • MOG and bovine casein cross-reactivity:

    • Antibodies against bovine casein can cross-react with myelin-associated glycoprotein (MAG)

    • In mouse models, casein immunization leads to severe spinal cord demyelination

    • Serum samples from MS patients show significantly higher reactivity to bovine casein than controls

    • This cross-reactivity suggests a potential environmental trigger (milk consumption) for MS in susceptible individuals

  • Experimental evidence:

    • Adsorption of sera from casein-immunized mice to bovine casein significantly reduced binding to both casein and MAG

    • IgG titers to recombinant mouse MAG increased over time after casein immunization

    • Patient serum studies showed correlation between B cell responses to bovine casein and CNS antigens

  • Implications for research and treatment:

    • Dietary factors may need to be considered in experimental design

    • Potential confounding factor in antibody studies

    • Suggests new avenues for therapeutic approaches combining personalized diet plans with disease-modifying treatments

    • Provides a model for studying environmental triggers in autoimmunity

This cross-reactivity research broadens our understanding of how environmental factors like diet may influence the etiology of MS and other demyelinating diseases, opening new research directions for prevention and treatment strategies .

What are the optimal storage and handling conditions for maintaining recombinant bovine MOG stability and activity?

Proper storage and handling of recombinant bovine MOG is critical for maintaining its stability and activity:

  • Storage conditions:

    • Short-term (1 month): 2-8°C

    • Long-term (12 months): -80°C in aliquots to avoid freeze-thaw cycles

    • Lyophilized form is more stable than solution

  • Buffer formulation:

    • Recommended buffer: 20mM Tris, 150mM NaCl, pH 8.0

    • Addition of stabilizers: 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose

    • Preservatives like Proclin300 may be included for long-term storage

  • Reconstitution protocol:

    • Reconstitute lyophilized protein in recommended buffer to a concentration of 0.1-1.0 mg/mL

    • Allow gentle dissolution without vortexing, which can cause denaturation

    • Filter sterilize if necessary (0.22 μm filter)

  • Stability assessment:

    • The thermal stability can be determined by accelerated degradation testing (37°C incubation)

    • Activity should be verified after extended storage using binding assays or functional tests

    • Avoid repeated freeze-thaw cycles, which significantly reduce activity

For research applications requiring consistent results, it's recommended to use freshly thawed aliquots and standardize handling procedures across experiments.

How can researchers optimize protocols for using recombinant bovine MOG in different experimental autoimmune encephalomyelitis (EAE) models?

Optimizing EAE induction with recombinant bovine MOG requires careful consideration of several factors:

  • Mouse strain selection:

    • C57BL/6: Standard strain for MOG35-55 peptide-induced EAE

    • Transgenic HLA-DR2+ mice: More suitable for human MOG studies and MS modeling

    • SJL/J mice: More appropriate for relapsing-remitting EAE models

  • Adjuvant optimization:

    • Complete Freund's Adjuvant (CFA) with 4-5 mg/mL Mycobacterium tuberculosis

    • Pertussis toxin administration (200-500 ng) on days 0 and 2 enhances BBB permeability

    • Timing of adjuvant administration can affect disease onset and severity

  • Dosing strategies:

    • Bovine MOG protein: 100-300 μg per mouse

    • MOG35-55 peptide: 100-200 μg per mouse

    • Multiple injection sites increase immunization efficiency

  • Disease monitoring parameters:

    • Clinical scoring: 5-point scale (0 = no disease, 5 = moribund/dead)

    • Weight loss monitoring (typically preceding clinical symptoms)

    • Histological assessment of demyelination and inflammation

    • Cytokine profiling (Th1/Th17 vs. Th2)

  • Therapeutic intervention protocols:

    • Preventive treatment: Start before EAE induction

    • Therapeutic treatment: Start at disease onset (clinical score ≥1)

    • Dose-dependent responses observed with recombinant TCR ligands (RTLs)

    • Some mice relapse after cessation of treatment, requiring re-treatment with higher doses

Example protocol optimization:
In a study using MOG/DR2 VG312 RTL for treating EAE, researchers found that daily treatment could induce long-term tolerance to MOG peptide and reverse clinical signs of EAE in a dose-dependent manner. Lower doses (33 μg) showed initial improvement but relapse after treatment cessation, while higher doses (100 μg) provided sustained protection .

What are the key considerations when designing experiments to investigate MOG-antibody interactions in vitro and in vivo?

Designing robust experiments to study MOG-antibody interactions requires careful planning:

  • In vitro binding studies:

    • Surface Plasmon Resonance (SPR):

      • Immobilize MOG on sensor chip to mimic multivalent exposure on oligodendrocytes

      • Use purified antibodies at concentrations 5× the expected Kd

      • Include both positive (8-18C5) and negative controls

      • Determine apparent equilibrium dissociation constants

    • Cell-Based Assays:

      • Use MOG-transfected cell lines (e.g., HEK293, EL-4)

      • Flow cytometry or immunofluorescence for detection

      • Include competition assays to identify overlapping epitopes

  • Epitope mapping strategies:

    • Mutational analysis of key residues (e.g., FG loop residues 103-104)

    • Peptide arrays covering the MOG sequence

    • Competition assays with characterized antibodies

    • Cross-species reactivity testing (human, mouse, bovine MOG)

  • Functional assays:

    • Complement-dependent cytotoxicity:

      • MOG-expressing cells + antibodies + complement source

      • Measure cell death via flow cytometry with viability dyes

    • Antibody-dependent cellular cytotoxicity:

      • Co-culture of MOG-expressing cells, antibodies, and effector cells

      • Measure target cell lysis

  • In vivo experiments:

    • Passive transfer models:

      • Inject MOG-specific antibodies into mice with sub-clinical EAE

      • Monitor for enhanced disease severity

      • Histological assessment of demyelination

    • B cell depletion studies:

      • Assess contribution of antibodies vs. B cell functions

      • Use in combination with MOG-specific T cells

  • Controls and validation:

    • Isotype-matched control antibodies

    • B cell-deficient mouse models

    • Fab fragment controls to distinguish Fc-dependent effects

    • Antibody absorption studies to confirm specificity

Example experimental design:
In a study investigating pathogenic MOG antibodies, researchers used SPR to measure binding affinities to different MOG variants, followed by competition assays to identify epitopes. They then injected the antibodies into mice with subclinical EAE and observed that mAbs recognizing at least four distinct epitopes could exacerbate EAE, demonstrating that pathogenicity is not restricted to a single epitope .

What new approaches are being developed for enhancing or modulating the immunogenicity of recombinant bovine MOG for therapeutic applications?

Several innovative approaches are being explored to modulate MOG immunogenicity:

  • Rationally designed TCR ligands:

    • Recombinant TCR ligands (RTLs) comprised of MHC domains linked to MOG peptides

    • These constructs can induce tolerance rather than autoimmunity

    • Example: MOG/DR2 VG312 RTL has shown promising results in reversing EAE signs

  • Controlled-release formulations:

    • Nanoparticle encapsulation for sustained delivery

    • Poly(ε-caprolactone) nanoparticles show advantages over PLGA, including avoiding acidic degradation products that could affect protein stability

    • These formulations enhance therapeutic efficacy compared to free MOG

  • Epitope modification strategies:

    • Altered peptide ligands with modified TCR contact residues

    • These can shift immune responses from pathogenic Th1 to regulatory Th2

    • Mechanism involves either antagonist/partial agonist signals or induction of Th2 phenotype T-cells

  • Combination approaches:

    • Co-delivery of MOG with immunomodulatory molecules

    • Targeted delivery to specific immune cell subsets

    • Integration with emerging therapies for demyelinating diseases

These approaches represent promising avenues for developing therapies that specifically target MOG-related autoimmunity while minimizing systemic immunosuppression.

How might genetic and post-translational variations in bovine MOG impact cross-species research and translational applications?

Genetic and post-translational variations in bovine MOG have significant implications:

  • Species-specific variations:

    • Sequence variations between bovine, human, and rodent MOG affect antibody recognition

    • Up to 15 splice variants exist in humans and non-human primates but not in rodents

    • These variants primarily differ in their cytoplasmic domains

    • Implications: Antibodies developed against bovine MOG may not recognize all human MOG isoforms

  • Post-translational modifications (PTMs):

    • Glycosylation patterns differ between species and expression systems

    • May affect conformational epitopes and antibody recognition

    • Production system (bacterial vs. mammalian) significantly impacts PTM patterns

    • Reduced antigenicity of recombinant MOG has been attributed to differences in PTM patterns

  • Research implications:

    • Need for careful validation when translating findings across species

    • Selection of appropriate MOG source based on research question

    • Potential for developing species-specific research tools

    • Consideration of PTMs when interpreting antibody binding data

  • Translational considerations:

    • Modified recombinant MOG with altered PTMs could serve as therapeutic vaccines

    • Understanding species differences helps predict human responses

    • Bovine MOG may serve as a source of cross-reactive epitopes relating to environmental exposures (e.g., dairy consumption)

    • These insights guide the development of personalized therapeutic approaches

By accounting for these variations, researchers can better translate findings from animal models to human applications and develop more effective targeted therapies for MOG-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.