Recombinant Bovine Myelin protein zero-like protein 3 (MPZL3)

Shipped with Ice Packs
In Stock

Description

Gene Information

The MPZL3 gene, which encodes for Myelin Protein Zero Like 3, is found in humans . The MPZL3 protein can be detected in keratinocytes and sebocytes found in the skin .

Role in Cancer

  • Prognostic Significance Kaplan-Meier analysis indicated that MPZL3 mRNA expression is related to prognosis in certain cancers such as GBM, BRCA, LGG, and PAAD .

  • Immune Cell Infiltration Algorithms like TIMER, MCPcounter, and CIBERSORT were used to investigate the relationship between immune cell infiltration levels and MPZL3 expression in different cancer types from the TCGA database .

  • Drug Sensitivity High MPZL3 expression can promote proliferation and enhance colony formation in MCF7, SKBR3, and MDA-MB-231 breast cancer cell lines .

    • MCF7 cells overexpressing MPZL3 had a higher IC50 value of fulvestrant, meaning that MPZL3 gene overexpression made ER-positive BC cells less sensitive to fulvestrant .

    • MDA-MB-231 cells overexpressing the MPZL3 gene were less sensitive to paclitaxel .

    • SKBR3 cells overexpressing the MPZL3 gene were more sensitive to pyrotinib .

Somatic Mutations

Mutations in the MPZL3 gene have been observed across different tissue types curated by the COSMIC database .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MPZL3; Myelin protein zero-like protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-234
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
MPZL3
Target Protein Sequence
LEIKADAHVRGYVGENIKLRCTFKSSSSITDKLTIDWTYRPPSSSRTESIFHYQSFQYPT TAGTFRDRISWVGDVYKGDASISISNPTMKDNGTFSCAVKNPPDVHHNIPATELTVTERG FGTMLSSVALLSILVFIPSTVVVILLLVRMGRKSAGLKKRSKSGYKKSSIEVSDDTDQEG DDCMAKLCVRCAECVDSDYEETY
Uniprot No.

Target Background

Function

Mediates homophilic cell-cell adhesion.

Database Links

KEGG: bta:521837

STRING: 9913.ENSBTAP00000001630

UniGene: Bt.7111

Protein Families
Myelin P0 protein family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the structural characterization of MPZL3?

MPZL3 is a single transmembrane protein with an immunoglobulin (Ig) V-type domain. The canonical structure of MPZL3 consists of:

  • Two transmembrane motifs flanking an extracellular Ig-like domain

  • The transmembrane motifs are positioned at amino acid positions 12-34 and 159-181

  • The extracellular Ig-like domain spans positions 31-148

  • A carboxy-terminal low complexity (LC) region

The R100Q mutation (identified in rc mice) is located within the recognition loop of the Ig-like domain, which plays crucial roles in T-cell receptors, cell-cell recognition, and cell adhesion . For structural analysis, researchers should employ both TMHMM and EBI InterProScan software for transmembrane domain prediction, and use Swiss-Model servers for 3D homology modeling with Myelin P0 protein precursor (1NEU) as a template sequence .

What experimental systems are available to study MPZL3 function?

Several experimental systems have been developed to study MPZL3 function:

  • Knockout mouse models: Global Mpzl3 knockout mice show severe cutaneous abnormalities, reduced adiposity, and increased energy expenditure .

  • Antisense oligonucleotide (ASO)-mediated knockdown: This approach allows acute and peripherally restricted knockdown of Mpzl3, which can ameliorate negative metabolic effects of high-fat diets without causing fur loss .

  • Cell culture systems:

    • NIH/3T3 cells transfected with MPZL3-Myc fusion proteins for protein expression studies

    • Keratinocyte models for studying epidermal differentiation

    • Ovarian cancer cell lines (OVCAR4 and OVCA433) for investigating MPZL3's role in EMT

  • Detection methods:

    • ELISA kits can detect MPZL3 at levels as low as 31.25 pg/mL and as high as 2000 pg/mL

    • Western blotting with affinity-purified polyclonal antibodies against MPZL3 peptides

How does MPZL3 expression vary across tissues and cell types?

MPZL3 shows a specific tissue distribution pattern, with expression data revealing:

  • High expression in:

    • Brain

    • Heart

    • Liver

    • Skin

  • Varied expression in:

    • Metabolically active tissues: brown adipose tissue (BAT), white adipose tissue (WAT), and skeletal muscle

    • Central nervous system

  • Cell-specific expression:

    • Mitochondrial localization in epidermal cells

    • Expression in Schwann cells, albeit at lower levels compared to MPZ

RT-PCR analysis can effectively detect different MPZL3 transcript variants, including two-exon and six-exon transcripts. For analyzing tissue-specific expression patterns, researchers should employ immunohistochemistry with validated antibodies that recognize specific MPZL3 epitopes .

How can researchers effectively distinguish between MPZL3 and other related proteins when conducting immunoassays?

Distinguishing MPZL3 from related proteins such as MPZ and MPZL2 (EVA1) requires specific methodological approaches:

  • Antibody validation protocol:

    • Perform preabsorption tests with specific peptides at various molar ratios (1:3, 1:10, and 1:32)

    • Verify specificity using fusion proteins with epitope tags (e.g., Myc-tagged MPZL3)

    • Conduct Western blot analysis to identify specific band patterns (MPZL3 typically shows bands at approximately 27 and 29 kDa)

  • Cross-reactivity assessment:

    • Test antibodies against recombinant proteins of all family members

    • Employ knockout cell lines or tissues as negative controls

    • Use mass spectrometry to confirm protein identity in immunoprecipitated samples

  • Recommended controls:

    • Include both wild-type and Mpzl3 knockout tissues

    • Test antibodies on cells transfected with MPZL3 versus empty vector

    • Include peptide competition assays to verify binding specificity

What are the optimal methods for investigating MPZL3's role in cell adhesion?

Based on research findings, MPZL3 functions as an adhesion molecule. To investigate this role:

  • Cell adhesion assay protocol:

    • Seed parental cells (e.g., OVCAR4 or ZTGFP) in 96-well plates

    • Stain MPZL3-knockdown or control cells with CellTrace Far Red

    • Add stained cells as a suspension to pre-seeded plates

    • Incubate for 30 minutes at 37°C

    • Wash off non-adherent cells with PBS (three 5-minute washes)

    • Visualize and quantify adherent cells using fluorescence microscopy

  • Spheroid formation and mesothelial clearance assay:

    • Stain MPZL3-knockdown or control cells with CellTrace Far Red

    • Seed into 96-well ultra-low attachment plates

    • Incubate overnight to form spheroids

    • Transfer spheroids to pre-seeded plates containing a mesothelial cell layer

    • Incubate for 48 hours

    • Image and analyze the cleared areas

  • Domain-specific functional analysis:

    • Perform rescue experiments using:

      • Full-length wild-type MPZL3

      • MPZL3 R99Q mutant (equivalent to the rc mouse mutation)

      • Truncation mutants lacking specific domains

    • Assess differentiation marker expression as a functional readout

What techniques are appropriate for analyzing MPZL3's mitochondrial function?

MPZL3 is localized to mitochondria and interacts with FDXR to regulate reactive oxygen species (ROS) production. To investigate this function:

  • Mitochondrial localization confirmation:

    • Perform subcellular fractionation to isolate mitochondria

    • Use confocal microscopy with mitochondrial markers (e.g., MitoTracker)

    • Conduct proteinase K protection assays to determine membrane topology

  • ROS measurement protocol:

    • Utilize fluorescent probes (e.g., DCFDA, MitoSOX)

    • Employ flow cytometry for quantification

    • Include positive controls (e.g., antimycin A) and negative controls (e.g., N-acetylcysteine)

  • Protein-protein interaction analysis:

    • Conduct co-immunoprecipitation to detect MPZL3-FDXR interaction

    • Perform proximity ligation assays for in situ detection

    • Use FRET or BiFC for live-cell analysis of interactions

How is MPZL3 implicated in metabolic disorders, and what are the best models to study this relationship?

MPZL3 plays a critical role in energy balance and metabolism:

  • Phenotypic characteristics of MPZL3 deficiency:

    • Reduced body weight and adiposity

    • Increased energy expenditure

    • Reduced hepatic lipid synthesis

    • Resistance to diet-induced obesity

    • Improved glucose tolerance

  • Experimental models:

    ModelAdvantagesLimitationsKey Findings
    Global Mpzl3 KO miceComplete protein lossDevelopmental compensations; Skin phenotype confounds metabolismReduced adiposity; Increased energy expenditure; Lower blood glucose
    Mpzl3 ASO treatmentAcute, tissue-specific knockdown; No skin phenotypeLess complete knockdown; Limited to peripheral tissuesDecreased fat mass; Reduced serum lipids; Improved glucose tolerance
    Tissue-specific KOAllows study of tissue-specific functionsTechnical complexity; Potential compensatory mechanismsTissue-specific effects on metabolism
  • Metabolic analysis methodology:

    • Measure respiratory exchange ratio (RER) to assess whole-body fat oxidation

    • Perform glucose tolerance tests (recommended protocol: 1g/kg glucose after 6-hour fast)

    • Analyze expression of genes regulating lipogenesis in white adipose tissue

    • Examine steroid hormone biosynthesis in liver and thermogenesis in brown adipose tissue

What is the evidence for MPZL3 as a biomarker or therapeutic target in autoimmune diseases?

Research suggests MPZL3 may serve as a biomarker for certain autoimmune conditions:

  • Diagnostic potential:

    • MPZL3 demonstrates strong predictive capabilities for Moyamoya disease (MMD) with AUC of 0.734

    • MPZL3 shows excellent predictive value for Systemic Lupus Erythematosus (SLE) with AUC of 1.000

  • Immune-related functions:

    • The IgV domain suggests involvement in cell adhesion, cell-cell interaction, and antigen binding

    • MPZL3 may influence T-cell activation and immune cell infiltration

  • Methodological approaches for validation:

    • Employ receiver operating characteristic (ROC) analysis with sufficient sample sizes

    • Validate across multiple cohorts to minimize overfitting

    • Assess correlation with established biomarkers and clinical parameters

    • Investigate mechanistic links between MPZL3 and immune pathways

How can researchers investigate MPZL3's role in cancer progression and drug sensitivity?

MPZL3 has emerging roles in cancer biology:

  • Expression analysis in cancer:

    • Analyze MPZL3 expression across different cancer types using TCGA data

    • Correlate with clinical parameters and molecular subtypes

    • Assess prognostic significance through survival analysis

  • Functional studies in cancer:

    • Generate stable MPZL3 overexpression or knockdown cell lines

    • Assess effects on proliferation, migration, and invasion

    • Investigate EMT marker expression (e.g., vimentin, N-cadherin)

  • Drug sensitivity assessment:

    • Test sensitivity to targeted therapies (EGFR, ABL, FGFR inhibitors)

    • Establish dose-response curves and calculate IC50 values

    • Investigate mechanisms of altered drug sensitivity

  • Molecular mechanisms:

    • Examine correlation with TMB, MSI, MMR, DNA methylation, and RNA modification

    • Analyze immune cell infiltration using ssGSEA algorithm

    • Investigate pathway enrichment (e.g., Notch signaling, heme metabolism)

How does the R100Q mutation in the MPZL3 Ig domain affect protein function?

The R100Q mutation, identified in rc mice, occurs within the conserved Ig V-type domain of MPZL3 and significantly impacts protein function:

  • Structural implications:

    • The mutation is within the recognition loop of the Ig-like domain

    • This region is known for roles in T-cell receptors and cell adhesion

    • The mutation affects a residue conserved across all vertebrate species

  • Functional consequences:

    • Results in a null phenotype, as demonstrated by comparable phenotypes between rc/rc mice and Mpzl3 knockout mice

    • Disrupts MPZL3's adhesion properties and signaling capabilities

    • May alter protein stability or trafficking

  • Experimental validation methods:

    • Perform rescue experiments in Mpzl3-deficient cells using wild-type versus R100Q mutant

    • Assess protein localization and stability using fluorescently tagged constructs

    • Investigate protein-protein interactions with both wild-type and mutant proteins

What signaling pathways are regulated by MPZL3?

MPZL3 influences multiple signaling pathways that regulate diverse cellular processes:

  • Epidermal differentiation pathway:

    • MPZL3 acts downstream of p63, ZNF750, KLF4, and RCOR1

    • These transcription factors bind near the MPZL3 gene and control its expression

    • MPZL3 loss alters the expression of 520 genes, with down-regulated genes enriched for epidermal differentiation functions

  • Metabolic regulation pathways:

    • Influences expression of genes regulating de novo lipogenesis in white adipose tissue

    • Affects genes associated with steroid hormone biosynthesis in liver

    • Regulates thermogenesis in brown adipose tissue

    • Impacts fatty acid transport in skeletal muscle

  • Cancer-related pathways:

    • Associated with EMT gene signature

    • Linked to DNA methylation and RNA modification

    • Connected to Notch signaling pathway and heme metabolism

  • Methodological approaches for pathway analysis:

    • Perform RNA sequencing following MPZL3 manipulation

    • Conduct Gene Ontology enrichment analysis

    • Utilize proximity analysis for network reconstruction

    • Validate key pathways through functional assays

How does MPZL3 interact with FDXR to regulate reactive oxygen species (ROS) in the context of epidermal differentiation?

The MPZL3-FDXR interaction represents a critical mechanism linking mitochondrial function to epidermal differentiation:

  • Interaction mechanism:

    • MPZL3 protein localizes to mitochondria

    • It directly interacts with FDXR (ferredoxin reductase)

    • This interaction is essential for epidermal differentiation

  • Functional consequence:

    • Together, MPZL3 and FDXR increase reactive oxygen species (ROS)

    • ROS induction is dependent upon promotion of FDXR enzymatic activity by MPZL3

    • This ROS elevation drives epidermal differentiation

  • Experimental approaches for investigation:

    • Use knockdown of both MPZL3 and FDXR to assess their interdependence

    • Measure ROS levels using specific probes

    • Perform domain mapping to identify interaction regions

    • Assess differentiation markers as functional readouts

    • Employ antioxidants to determine if phenotypes are ROS-dependent

What are the optimal conditions for producing and purifying recombinant bovine MPZL3?

For optimal production of recombinant bovine MPZL3:

  • Expression system selection:

    • Mammalian expression systems (HEK293) are preferred for proper post-translational modifications

    • Baculovirus-insect cell systems can provide higher yields while maintaining most modifications

    • Bacterial systems may be used for domains lacking glycosylation sites

  • Purification strategy:

    • Employ affinity tags (His, GST, or Fc) for initial capture

    • Follow with ion exchange chromatography for higher purity

    • Perform size exclusion chromatography as a final polishing step

    • Consider tag removal if it interferes with functional assays

  • Quality control assessment:

    • Verify protein identity using mass spectrometry

    • Assess purity by SDS-PAGE (>95% purity is recommended)

    • Confirm proper folding using circular dichroism

    • Test biological activity in appropriate functional assays

How can researchers accurately quantify MPZL3 in biological samples?

For accurate quantification of MPZL3 in biological samples:

  • ELISA methodology:

    • Use sandwich ELISA with antibodies specific for MPZL3

    • Standard curves should range from 31.25 pg/mL to 2000 pg/mL

    • Sample types can include serum, plasma, and other biological fluids

    • Expected intra-assay CV: <7.1%; inter-assay CV: <10.3%

  • Western blot quantification:

    • Use affinity-purified antibodies against specific MPZL3 epitopes

    • Look for characteristic bands at approximately 27 and 29 kDa

    • Include proper loading controls and standard curves

    • Employ image analysis software for densitometry

  • mRNA quantification:

    • Design primers specific to MPZL3 transcripts (both two-exon and six-exon variants)

    • Use RT-qPCR with validated reference genes

    • Consider digital PCR for absolute quantification

    • Account for multiple transcript variants in analysis

What considerations are important when designing MPZL3 knockdown or knockout experiments?

When designing MPZL3 knockdown or knockout experiments:

  • Selection of approach:

    MethodAdvantagesLimitationsApplications
    Global KOComplete protein lossDevelopmental effects; Whole-body phenotypeFundamental role studies
    Conditional KOTissue-specific; Temporal controlTechnical complexity; Incomplete recombinationTissue-specific functions
    ASO-mediated knockdownAcute effect; Peripheral restriction; Dose-dependentIncomplete knockdown; Limited CNS penetrationTherapeutic potential studies
    siRNA/shRNARapid implementation; Cost-effectiveTransient effect; Off-target concernsInitial screening
    CRISPR/Cas9Precise editing; Complete KOOff-target effects; Technical challengesMechanistic studies
  • Critical controls:

    • Include both wild-type and heterozygous animals/cells

    • Use multiple knockdown/knockout approaches to confirm phenotypes

    • Perform rescue experiments with wild-type MPZL3

    • Compare with known phenotypes (e.g., rc mouse)

  • Phenotypic analysis recommendations:

    • Assess both cutaneous and metabolic parameters

    • Examine cell adhesion and differentiation

    • Measure ROS levels and mitochondrial function

    • Consider tissue-specific effects

    • Evaluate both acute and chronic consequences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.