Recombinant Bovine N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (PIGL)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Biological Role

PIGL is a transmembrane enzyme localized to the endoplasmic reticulum (ER) and nuclear envelope . In GPI biosynthesis, it performs the second catalytic step, enabling subsequent mannosylation and ethanolamine phosphate modifications essential for anchoring proteins like prions, receptors, and adhesion molecules to cell membranes . Bovine PIGL shares structural and functional homology with human and rodent orthologs, featuring conserved catalytic domains critical for substrate binding and deacetylation .

Research Applications

Recombinant bovine PIGL is utilized in:

  • GPI biosynthesis studies: Elucidating enzymatic kinetics and substrate specificity .

  • Disease modeling: Investigating GPI anchor deficiencies linked to neurodevelopmental disorders (e.g., CHIME syndrome) .

  • Therapeutic development: Screening inhibitors for parasitic infections reliant on GPI anchors (e.g., Trypanosoma) .

Challenges and Future Directions

While recombinant bovine PIGL is stable under standard storage conditions, its transmembrane nature complicates solubilization and crystallization . Future work may focus on:

  • Structural resolution: Cryo-EM studies to map active-site dynamics.

  • Functional assays: High-throughput screens for modulators of GPI biosynthesis.

  • Cross-species compatibility: Testing activity in hybrid systems (e.g., human cell lines) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PIGL; N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; Phosphatidylinositol-glycan biosynthesis class L protein; PIG-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PIGL
Target Protein Sequence
MEVAAPLLCLAAAVLVWGVLWVWGSWERMTRPEQAGLPGGGSRTLLVTAHPDDEAMFFAPTILGLARLRHQLFLLCFSAGNYYNQGEIRKKELLQSCDVLGIPPSNVMIIENRDFPDDPDVRWDPDRAADVLLQHVEANGIKLVVTFDEGGVSGHSNHVALNAAVRTLQAEGKLPKGCSVLTLQSVNLLRKYLCLLDLPCSLLLARDALFVLTQREAAQAQRAMSCHRSQLLWFRRLYMLFSRYMRINSLNFL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the second step of glycosylphosphatidylinositol (GPI) biosynthesis. Specifically, it catalyzes the de-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.
Database Links
Protein Families
PIGL family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is PIGL and what role does it play in cellular biochemistry?

PIGL (phosphatidylinositol glycan anchor biosynthesis, class L) encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis. Specifically, it performs the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI) . This enzyme belongs to the family of hydrolases acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amides. The systematic name for this enzyme is 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol acetylhydrolase . The chemical reaction catalyzed by PIGL can be represented as:

6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H₂O → 6-(alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + acetate

The enzyme participates in three key metabolic pathways: glycosylphosphatidylinositol (GPI)-anchor biosynthesis and glycan structures biosynthesis pathways . Similar to other enzymes in this pathway, PIGL likely localizes to the endoplasmic reticulum, as suggested by studies of related rat enzymes .

What are the common experimental methods for expressing recombinant Bovine PIGL?

Recombinant Bovine PIGL can be expressed using several systems, with E. coli and mammalian cells being the most common. Based on available research protocols, the following methodological approach is recommended:

For bacterial expression:

  • Clone the full-length bovine PIGL coding sequence into a bacterial expression vector (pET or pGEX systems are commonly used)

  • Transform into an expression strain of E. coli (BL21 or Rosetta for handling eukaryotic proteins)

  • Induce expression using IPTG at concentrations between 0.1-1.0 mM

  • Grow cultures at lower temperatures (16-25°C) to enhance solubility

  • Use affinity tags such as His, Avi, or DDK for purification

For mammalian expression:

  • Clone the bovine PIGL sequence into vectors with strong promoters (CMV-based)

  • Transfect HEK293 cells, which have shown good expression results for PIGL

  • Create stable cell lines using appropriate selection markers

  • Harvest cells after 48-72 hours for transient expression

  • Use affinity chromatography with tags such as Fc, Myc, or His for protein isolation

When designing expression constructs, it's important to consider the membrane-associated nature of PIGL and potentially include detergent solubilization steps during purification.

How can researchers effectively measure PIGL enzymatic activity?

PIGL activity can be measured using several techniques, with the following protocol representing current best practices:

  • Substrate preparation: Synthesize or obtain radiolabeled GlcNAc-PI substrate (typically using [³H] or [¹⁴C])

  • Reaction setup:

    • Buffer composition: 50 mM HEPES (pH 7.5), 10 mM MnCl₂, 1 mM DTT

    • Substrate concentration: 0.5-5 μM GlcNAc-PI

    • Enzyme concentration: 0.1-1 μg purified enzyme

    • Volume: 50-100 μl

    • Incubation: 30-60 min at 37°C

  • Activity detection methods:

    • Thin-layer chromatography (TLC) separation of substrate and product

    • HPLC analysis with MS detection

    • Ion-pair HPLC-electrospray ionization-MS/MS method (similar to that used for TbGNA1)

  • Calculation of activity:

    • Determine the ratio of product to substrate

    • Calculate enzyme activity in nmol product formed per minute per mg protein

For validation, inhibitors like acetate (product inhibition) can be used as controls. When analyzing PIGL activity, researchers should monitor changes in UDP-GlcNAc levels as an indirect measure of pathway function, as demonstrated in analogous studies with TbGNA1 .

What are the structural characteristics of PIGL that contribute to its function?

While the exact crystal structure of bovine PIGL has not been fully characterized in the available search results, insights can be drawn from structurally related enzymes. The enzyme belongs to the hydrolase family (EC 3.5.1) that acts on carbon-nitrogen bonds . Key structural features likely include:

  • Catalytic domain: Contains residues essential for deacetylation activity

  • Substrate binding pocket: Accommodates the GlcNAc-PI substrate

  • Membrane association domain: PIGL is likely anchored to the ER membrane

  • Conservation: High sequence conservation in the catalytic region across species

For structural studies, researchers should consider:

  • X-ray crystallography approaches (similar to those used for TbGNA1, which was resolved at 1.86 Å resolution)

  • Molecular modeling using homologous proteins as templates

  • Site-directed mutagenesis of putative catalytic residues to confirm their functional roles

Understanding the structure-function relationship is essential for developing specific inhibitors and understanding the molecular basis of PIGL-related disorders.

What knockout methodologies have proven successful for studying PIGL function in model organisms?

Based on research with related enzymes, successful knockout strategies for PIGL include:

  • Conditional gene knockout system:

    • Similar to the approach used for TbGNA1 in Trypanosoma brucei, a tetracycline-inducible system allows controlled gene expression

    • This approach enables observation of immediate effects of gene deletion before secondary compensatory mechanisms develop

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting exonic regions of PIGL

    • Use homology-directed repair with donor templates containing selection markers

    • Verify knockout by PCR, Southern blotting, and Western blotting

  • Vector-based knockout constructs:

    • Similar to the approach used for GPI12 in Leishmania major, where pLEXSY-neo2 and pLEXSY-hyg2 vectors were employed

    • This involves replacing the target gene with selection markers through homologous recombination

When designing knockout experiments, researchers should include appropriate controls and validation methods:

  • PCR verification of gene deletion

  • Southern blotting to confirm genomic integration

  • Western blotting to verify protein absence

  • Complementation studies to confirm phenotype specificity

The approach used for GPI12 in Leishmania provides a valuable template, where molecular constructs were confirmed by Colony PCR and sequencing, followed by transfection via electroporation .

What are the effects of PIGL deficiency on cellular glycosylation patterns?

Studies on related enzymes in the GPI biosynthesis pathway provide insights into the effects of PIGL deficiency on glycosylation:

  • Reduction in GPI-anchored proteins:

    • Similar to observations in TbGNA1-deficient cells, PIGL deficiency would likely result in decreased surface expression of GPI-anchored proteins

    • This effect manifests progressively as UDP-GlcNAc levels decrease

  • Alterations in N-linked glycan structures:

    • Significant reduction in poly-N-acetyllactosamine structures

    • Changes in high-molecular-mass glycoproteins detectable by lectins

  • Surface glycoprotein modification:

    • In TbGNA1 conditional null mutants, variant surface glycoproteins (VSGs) showed modified glycosylation profiles

    • VSG molecules selectively lost N-linked glycans from specific sites

The following table summarizes the expected changes in sugar nucleotide concentrations based on data from TbGNA1 knockouts:

Sugar nucleotideWild type (pmol/10⁷ cells)48h after PIGL suppression (estimated)
UDP-glucose182 ± 15Relatively unchanged
UDP-galactose44 ± 9Relatively unchanged
UDP-GlcNAc209 ± 12Reduced to ~6% of normal levels
GDP-mannose12 ± 4Relatively unchanged

This pattern is consistent with PIGL's role early in the GPI biosynthesis pathway, affecting primarily the UDP-GlcNAc-dependent processes .

What biochemical and cell biology assays are recommended for characterizing PIGL mutants?

For comprehensive characterization of PIGL mutants, the following assays are recommended:

  • Sugar nucleotide quantification:

    • Extract and analyze sugar nucleotides using ion-pair HPLC-electrospray ionization-MS/MS

    • Focus on UDP-GlcNAc levels as a primary indicator of pathway disruption

    • Use GDP-glucose as an internal standard (not naturally present in many systems)

  • Glycoprotein analysis:

    • Western blotting with lectins (e.g., tomato lectin for poly-N-acetyllactosamine structures)

    • SDS-PAGE analysis of surface glycoproteins to detect mobility shifts indicating glycosylation changes

    • Mass spectrometry of purified glycoproteins to characterize specific glycan alterations

  • Cell viability and growth assessments:

    • Growth curves under permissive and non-permissive conditions

    • Cell morphology analysis by microscopy

    • Flow cytometry with annexin V/propidium iodide to assess apoptosis and cell death

  • Localization studies:

    • Immunofluorescence microscopy with ER markers to confirm subcellular localization

    • Fractionation studies to biochemically validate localization

    • Creation of GFP-fusion proteins to visualize in live cells

  • Complementation assays:

    • Reintroduction of wild-type PIGL to confirm phenotype reversibility

    • Cross-species complementation to assess functional conservation

    • Structure-function analysis using point mutants in key residues

These assays provide comprehensive insights into both the molecular and cellular consequences of PIGL deficiency.

How can researchers differentiate between PIGL and other enzymes in the GPI biosynthesis pathway?

Distinguishing PIGL activity from other enzymes in the GPI biosynthesis pathway requires specific experimental approaches:

  • Substrate specificity:

    • PIGL specifically deacetylates GlcNAc-PI to generate GlcN-PI

    • Use of synthetic substrates with modifications at specific positions can help determine enzyme specificity

  • Inhibitor profiles:

    • Develop and test specific inhibitors targeting the deacetylase activity

    • Compare inhibition patterns with other enzymes in the pathway

  • Genetic approaches:

    • Complementation studies in knockout models

    • Overexpression of PIGL in cells with deficiencies in other pathway enzymes

  • Biochemical separation:

    • Sequential enzymatic reactions with purified enzymes

    • Analysis of reaction intermediates by mass spectrometry

  • Structural analysis:

    • Comparison of crystal structures (when available)

    • Molecular docking studies with substrates and inhibitors

When analyzing experimental results, researchers should be aware that deficiencies in PIGL will affect early steps in GPI biosynthesis, similar to but distinct from effects observed with other enzymes like UDP-GlcNAc pyrophosphorylase (UAP) .

What are the key considerations when designing inhibitors for PIGL?

Designing effective and specific inhibitors for PIGL requires attention to several critical factors:

  • Target site identification:

    • Focus on the catalytic domain responsible for deacetylase activity

    • Consider the substrate binding pocket that accommodates GlcNAc-PI

    • Analyze conserved residues across species to identify essential sites

  • Inhibitor characteristics:

    • Design transition state analogs that mimic the reaction intermediate

    • Consider substrate analogs with modifications at the acetyl group

    • Develop compounds that can access the ER membrane where PIGL is located

  • Selectivity considerations:

    • Ensure specificity against other deacetylases in the cell

    • Test against related enzymes in the GPI biosynthesis pathway

    • Evaluate cross-species reactivity if targeting pathogen enzymes

  • Validation approaches:

    • Enzymatic assays with purified recombinant PIGL

    • Cellular assays measuring GPI-anchored protein expression

    • Analysis of sugar nucleotide levels, particularly UDP-GlcNAc

  • Potential screening methodologies:

    • High-throughput enzymatic assays using fluorescent substrates

    • Fragment-based drug design

    • Virtual screening based on homology models or crystal structures

The essentiality of GPI biosynthesis in various organisms, as demonstrated with TbGNA1 in T. brucei and GPI12 in Leishmania , suggests that PIGL inhibitors could have significant therapeutic potential, particularly against parasitic infections.

How does PIGL research contribute to understanding parasitic disease mechanisms?

PIGL research has significant implications for understanding parasitic diseases, particularly those caused by trypanosomatids:

  • Essential nature in parasite survival:

    • Studies on GPI12 (a PIGL ortholog) in Leishmania major demonstrated its importance for parasite viability

    • Similar research on TbGNA1 in Trypanosoma brucei showed that disruption of the GPI biosynthesis pathway leads to parasite death

  • Roles in host-parasite interactions:

    • GPI-anchored molecules are critical for parasite surface coat formation

    • Modifications to variant surface glycoproteins (VSGs) affect immune evasion strategies

  • Metabolic vulnerabilities:

    • UDP-GlcNAc depletion following disruption of the pathway enzymes provides insights into parasite metabolism

    • The dramatic reduction to approximately 6% of normal UDP-GlcNAc levels within 48 hours of enzyme depletion indicates rapid turnover and essential function

  • Vaccine development potential:

    • Recombinant parasites with modified GPI biosynthesis may serve as live attenuated vaccine candidates

    • As noted in Leishmania research: "With the use of molecular constructs, it was possible to remove and study gene GPI12 and to achieve a live recombinant Leishmania parasite that maintained the original form of the antigenic parasites. This achievement can be used as an experimental model for vaccine development studies."

Future parasitology research should focus on comparative studies between mammalian and parasite PIGL enzymes to identify structural and functional differences that could be exploited therapeutically.

What are the current technical challenges in studying PIGL and potential solutions?

Researchers face several technical challenges when studying PIGL:

  • Membrane protein expression and purification:

    • Challenge: PIGL is likely membrane-associated, making it difficult to express and purify in active form

    • Solution: Use specialized detergents (DDM, CHAPS) during purification; consider fusion tags that enhance solubility; explore membrane mimetics like nanodiscs

  • Developing specific activity assays:

    • Challenge: Distinguishing PIGL activity from other deacetylases

    • Solution: Design fluorescent or chromogenic substrates specific to PIGL; develop coupled enzyme assays; use mass spectrometry for direct product detection

  • Structural characterization:

    • Challenge: Obtaining crystal structures of membrane-associated enzymes

    • Solution: Use cryo-EM as an alternative approach; consider crystallizing soluble domains; employ computational modeling based on homologous proteins

  • In vivo functional analysis:

    • Challenge: Embryonic lethality in knockout models

    • Solution: Implement conditional or tissue-specific knockout strategies; use CRISPR-Cas9 for precise genetic modifications; develop inducible expression systems similar to those used for TbGNA1

  • Species-specific differences:

    • Challenge: Extrapolating between bovine, human, and parasite PIGL functions

    • Solution: Conduct thorough comparative studies; use complementation experiments across species; create chimeric proteins to identify functionally important domains

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and computational methods.

How can researchers effectively troubleshoot experimental issues with recombinant PIGL?

When encountering difficulties with recombinant PIGL experiments, consider the following troubleshooting strategies:

  • Low expression yields:

    • Check codon optimization for the expression system

    • Modify growth conditions (temperature, induction time, media composition)

    • Test different fusion tags (His, GST, MBP) to enhance solubility

    • Consider specialized expression strains for membrane proteins

  • Protein inactivity after purification:

    • Verify protein folding using circular dichroism spectroscopy

    • Test different buffer compositions and pH conditions

    • Add stabilizing agents (glycerol, reducing agents)

    • Minimize freeze-thaw cycles and store appropriately

    • Ensure proper cofactors are present in activity assays

  • Inconsistent enzymatic assay results:

    • Standardize substrate preparation and quality

    • Control for product inhibition effects

    • Include appropriate positive and negative controls

    • Consider time-course experiments to identify optimal reaction conditions

  • Difficulties with cellular localization studies:

    • Test antibody specificity with appropriate controls

    • Optimize fixation and permeabilization protocols

    • Use multiple approaches (biochemical fractionation, microscopy)

    • Consider endogenous tagging approaches to avoid overexpression artifacts

  • Knockout verification challenges:

    • Employ multiple validation methods (PCR, Southern blot, Western blot)

    • Design primers to detect both integration and original locus

    • Sequence across integration junctions to confirm precise editing

    • Perform functional complementation to verify phenotype specificity

When planning troubleshooting experiments, researchers should implement systematic approaches that isolate variables and include appropriate controls at each step.

How does bovine PIGL compare to its orthologs in other species?

Bovine PIGL shares significant similarities with its orthologs in other species, but also exhibits species-specific characteristics:

  • Conservation across mammals:

    • High sequence similarity in the catalytic domains between bovine and human PIGL

    • Conserved subcellular localization to the endoplasmic reticulum

    • Similar roles in the GPI biosynthesis pathway

  • Differences from microbial orthologs:

    • Parasite orthologs (like GPI12 in Leishmania) may have structural differences that could be exploited for selective targeting

    • Potential differences in substrate specificity or catalytic efficiency

    • Varying sensitivity to inhibitors

  • Functional conservation:

    • The essential nature of PIGL function appears to be conserved across species

    • Knockout studies in parasites demonstrate severe growth defects and lethality

    • Similar biochemical reactions catalyzed across species

Evolutionary analysis suggests that PIGL represents a highly conserved enzyme due to its essential role in GPI biosynthesis, a pathway critical for eukaryotic cell function. Comparative studies between bovine PIGL and its orthologs provide valuable insights into both fundamental aspects of eukaryotic biology and potential therapeutic targets in pathogenic organisms.

What insights can cross-species complementation studies provide about PIGL function?

Cross-species complementation studies with PIGL can reveal important insights about evolutionary conservation and functional domains:

  • Functional conservation assessment:

    • Determine if bovine PIGL can rescue phenotypes in other species (human, yeast, parasite) lacking their native enzyme

    • Identify the degree of functional interchangeability between species

  • Domain mapping through chimeric proteins:

    • Create fusion proteins combining domains from different species

    • Identify which regions are responsible for species-specific functions

    • Map catalytic domains versus regulatory or localization elements

  • Substrate specificity analysis:

    • Compare kinetic parameters of enzymes from different species with standardized substrates

    • Identify differences in substrate recognition that might inform inhibitor design

  • Inhibitor cross-reactivity:

    • Test inhibitors designed against one species ortholog against enzymes from other species

    • Develop selective inhibitors based on species-specific differences

  • Experimental design considerations:

    • Use expression systems compatible with the protein source

    • Ensure proper subcellular localization in heterologous systems

    • Verify expression levels comparable to endogenous protein

These studies not only contribute to fundamental understanding of PIGL biology but also provide practical insights for therapeutic development targeting parasite orthologs while minimizing effects on mammalian enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.