Recombinant Bovine N-acetyltransferase 14 (NAT14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
Probable N-acetyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA SFALALLLPVFLAVAAMKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGSSAG DGARVTRLSVSRWHRRRGVGRRLLAFAESRARAWAGGMGEPRARLVVPVAVAAWGVAGML EGCGYQAEGSWGCMGYTLVREFSKEL
Uniprot No.

Target Background

Function

Probable acetyltransferase. May function as a transcription factor, regulating coproporphyrinogen oxidase expression through binding to a promoter regulatory element.

Database Links

KEGG: bta:532809

STRING: 9913.ENSBTAP00000025357

UniGene: Bt.8928

Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant Bovine NAT14?

Several expression systems have been successfully used to produce Recombinant Bovine NAT14, each with distinct advantages:

Expression SystemAdvantagesTypical YieldCommon Tags
Cell-free protein synthesis (CFPS)Rapid production, handles difficult-to-express proteins, allows post-translational modifications>70-80% purityStrep-Tag, His-Tag
Mammalian cellsNative folding, proper post-translational modifications>80% purityHis-Tag
E. coliHigh yield, cost-effective, scalableVariableHis-Tag

For research requiring post-translational modifications, the ALiCE® cell-free protein synthesis system has shown particular effectiveness as it contains mitochondria and protein production machinery from Nicotiana tabacum c.v. . This system is beneficial when studying NAT14's enzymatic activity, as it maintains the protein in a near-native state.

For quantitative enzymatic assays, purification through nickel-nitrilotriacetic acid (Ni-NTA) resin chromatography followed by size exclusion chromatography (SEC) is recommended to ensure high purity .

How can NAT14 activity be measured in experimental settings?

NAT14 enzymatic activity can be measured through several methods:

  • Spectrophotometric assays: Monitoring the formation of CoA via reaction with DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) at 405-412 nm.

  • HPLC-based assays: Separating and quantifying acetylated products using reverse-phase HPLC. This method has been successfully used for NAT family proteins to measure acetylation of various substrates .

  • Thermal stability assays: Using differential scanning fluorimetry (DSF) to determine the thermal midpoint (Tm) of NAT14 and monitor shifts upon interaction with substrates or products .

For optimal results, enzymatic assays should be conducted using 100 mM imidazole chromatographic fractions of the recombinant protein, with appropriate buffers that maintain pH between 7.0-7.5 .

How does NAT14 compare functionally to other members of the NAT family?

While NAT1 and NAT2 have been extensively characterized for their roles in xenobiotic metabolism, NAT14 is less studied but shows distinct functional characteristics:

NAT Family MemberPrimary FunctionTypical SubstratesRegulatory Mechanism
NAT1Metabolism of aromatic aminesp-aminobenzoic acid (PABA), 4-aminobiphenyl (4-ABP)Affected by SNPs like G560A (R187Q)
NAT2Drug metabolismHydrazine drugs, aromatic aminesGenetic polymorphisms affect slow/rapid acetylator phenotypes
NAT10mRNA N4-acetylcytidine modificationRNA cytosine residuesEssential for precise regulation of translation
NAT14Probable transcriptional regulationBinds 5'-GGACTACAG-3' sequenceMay function in regulating gene expression

Research comparing the acetylation efficiency of NAT14 against NAT1 substrates (like PABA or 4-ABP) could provide valuable insights into substrate specificity patterns. Methodologically, this requires:

  • Expressing recombinant NAT14 and NAT1 under identical conditions

  • Conducting parallel acetylation assays with varying concentrations of AcCoA (31.3–1,000 µM) and fixed substrate concentrations

  • Analyzing reaction products using HPLC to determine kinetic parameters (Km, Vmax)

What techniques are most effective for studying NAT14 binding to DNA?

Since NAT14 binds to specific DNA sequences (5'-GGACTACAG-3'), the following methods are recommended:

  • Chromatin Immunoprecipitation sequencing (ChIP-seq): This technique has been successfully used for studying DNA-protein interactions in related contexts . For NAT14 specifically:

    • Use crosslinking with 1% formaldehyde for 10 minutes

    • Sonicate chromatin to 200-500bp fragments

    • Immunoprecipitate with anti-NAT14 antibodies

    • Sequence and map binding sites genome-wide

  • Electrophoretic Mobility Shift Assay (EMSA): Useful for confirming direct binding to specific sequences:

    • Incubate purified recombinant NAT14 with 32P-labeled DNA oligonucleotides containing the 5'-GGACTACAG-3' sequence

    • Run on non-denaturing polyacrylamide gel

    • Visualize shifts indicating protein-DNA binding

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics:

    • Immobilize DNA containing the binding motif on sensor chip

    • Flow purified NAT14 at different concentrations

    • Measure association/dissociation rates to determine affinity constants

How can low-input sequencing methods be adapted to study NAT14-mediated acetylation?

Based on recent developments in studying N-acetyltransferases, the LACE-seq (Linear Amplification of cDNA Ends and sequencing) method can be adapted for NAT14 research :

  • NAT14 LACE-seq Protocol Adaptation:

    • Crosslink NAT14 to its RNA or DNA substrates

    • Fragment substrates to optimal size (100-200 nucleotides)

    • Perform reverse transcription, which terminates at crosslink sites

    • Linearly amplify cDNA using T7 in vitro transcription

    • Prepare sequencing library and sequence

    • Analyze data to identify NAT14 binding or modification sites

This method is particularly valuable for samples with limited material (as few as 50 cells) , making it suitable for tissue-specific studies where bovine NAT14 expression may be limited.

What are the optimal conditions for maintaining NAT14 stability and activity?

Recombinant Bovine NAT14 requires specific storage and handling conditions:

ParameterRecommended ConditionNotes
Storage temperature-20°C to -80°C for long-termAvoid repeated freeze-thaw cycles
Working storage4°C for up to one weekIn buffer with 50% glycerol
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
pH range7.0-7.5Activity significantly decreases outside this range

For enzymatic assays, thermal stability studies indicate that monitoring the midpoint temperature (Tm) via differential scanning fluorimetry can identify optimal buffer conditions that maintain NAT14 in its active conformation .

How can NAT14 polymorphisms be identified and characterized in bovine populations?

Identifying and characterizing NAT14 polymorphisms requires a systematic approach:

  • Genomic Analysis:

    • Extract DNA from bovine tissue or blood samples

    • Amplify the NAT14 coding region using PCR with primers flanking the coding sequence

    • Perform direct sequencing of 1.6-kb fragments

    • Compare sequences to reference bovine genome to identify SNPs

  • Functional Characterization:

    • Express wild-type and variant NAT14 in cell-free or mammalian expression systems

    • Purify using affinity chromatography

    • Assess enzymatic activity with various substrates

    • Determine kinetic parameters (Km, Vmax) to quantify effects of polymorphisms

    • Evaluate thermal stability of variants compared to wild-type

  • Population Studies:

    • Develop genotyping assays for identified polymorphisms

    • Screen diverse bovine populations to determine allele frequencies

    • Correlate genotypes with phenotypic data (if available)

This approach has been successful in characterizing human NAT1 variants and can be adapted for bovine NAT14.

How should kinetic data for NAT14 enzymatic activity be analyzed?

Proper analysis of NAT14 kinetic data requires:

  • Michaelis-Menten Kinetics:

    • Determine apparent Km and Vmax by varying substrate concentration while keeping cofactor (AcCoA) concentration fixed

    • Plot reaction velocity versus substrate concentration

    • Fit data to Michaelis-Menten equation using non-linear regression

    • Compare kinetic parameters between different substrates or variants

  • Double-Reciprocal (Lineweaver-Burk) Analysis:

    • Plot 1/v versus 1/[S] to identify potential inhibition patterns

    • Calculate Km and Vmax from the slope and y-intercept

  • Bisubstrate Kinetics:

    • For determining the kinetic mechanism, vary both AcCoA and substrate concentrations

    • Analyze data using appropriate equations for sequential or ping-pong mechanisms

When comparing NAT14 variants or examining different cofactors, it is critical to standardize protein concentration through quantitative Western blot or protein assay methods .

What statistical approaches are appropriate for analyzing NAT14 binding site data?

For analyzing NAT14 binding site data from ChIP-seq or similar experiments:

  • Peak Calling:

    • Use MACS2 or similar algorithms to identify statistically significant NAT14 binding regions

    • Apply false discovery rate (FDR) correction for multiple testing

    • Consider a q-value threshold of <0.05 for significance

  • Motif Analysis:

    • Use MEME-ChIP or similar tools to identify enriched sequence motifs within peaks

    • Compare discovered motifs to the known 5'-GGACTACAG-3' binding sequence

    • Calculate position weight matrices to quantify binding preferences

  • Functional Enrichment Analysis:

    • Perform gene ontology (GO) analysis of genes near NAT14 binding sites

    • Use pathway enrichment tools like IPA (Ingenuity Pathway Analysis) to identify biological functions associated with NAT14-regulated genes

    • Compare enriched functions with known NAT14 biology

How can low yield or activity of Recombinant Bovine NAT14 be addressed?

When encountering issues with NAT14 expression or activity:

ProblemPotential CausesSolutions
Low expression yieldProtein toxicity, codon bias, hydrophobic natureUse cell-free expression systems, optimize codon usage, add solubility tags
Poor solubilityTransmembrane regions, protein aggregationInclude detergents in buffer, express as fusion protein with solubility enhancers
Low enzymatic activityImproper folding, cofactor depletion, buffer incompatibilityOptimize buffer conditions, ensure fresh AcCoA, verify protein folding
Protein degradationProtease contamination, thermal instabilityAdd protease inhibitors, maintain cold chain, add stabilizing agents like glycerol

For cell-free expression specifically, the ALiCE® system has shown success with NAT14 due to its ability to handle difficult-to-express proteins with post-translational modifications .

How can specificity of NAT14 antibodies be validated for research applications?

Validating antibody specificity for NAT14 research requires multiple approaches:

  • Western Blot Validation:

    • Test antibody against recombinant NAT14 (positive control)

    • Include negative controls (non-transfected cell lysates)

    • Verify single band at expected molecular weight (~21.7 kDa)

    • Perform peptide competition assay to confirm specificity

  • Immunohistochemistry Validation:

    • Use appropriate dilutions (1/50 - 1/100) as determined for similar NAT antibodies

    • Include tissue samples known to express NAT14

    • Perform negative controls with secondary antibody only

    • Compare staining pattern with mRNA expression data

  • Cross-Reactivity Testing:

    • Test against related NAT family proteins to ensure specificity

    • Evaluate reactivity across species (human, mouse, bovine) if using for comparative studies

How can Recombinant Bovine NAT14 be used to study transcriptional regulation?

Given NAT14's ability to bind specific DNA sequences and potentially activate transcription:

  • Reporter Gene Assays:

    • Clone the 5'-GGACTACAG-3' sequence upstream of a minimal promoter driving luciferase expression

    • Co-transfect cells with NAT14 expression vector and reporter construct

    • Measure luciferase activity to quantify transcriptional activation

    • Use mutated binding sequences as controls

  • Chromatin Conformation Capture (3C):

    • Investigate whether NAT14 binding influences chromatin looping or architecture

    • Crosslink protein-DNA complexes, digest with restriction enzymes

    • Ligate fragments in dilute conditions, then PCR amplify junctions

    • Sequence to identify long-range interactions mediated by NAT14

  • Transcriptome Analysis:

    • Perform RNA-seq in systems with NAT14 overexpression or knockdown

    • Identify differentially expressed genes

    • Correlate with NAT14 binding sites to distinguish direct from indirect effects

What is the role of NAT14 in comparison to NAT10 in RNA modification?

While NAT10 has been shown to catalyze N4-acetylcytidine (ac4C) modification of RNA , the potential role of NAT14 in RNA modification remains less clear:

  • Comparative Analysis Approach:

    • Express recombinant NAT14 and NAT10 using identical systems

    • Perform in vitro RNA modification assays with various RNA substrates

    • Use mass spectrometry to identify and quantify modification products

    • Compare substrate specificity and catalytic efficiency

  • ac4C LACE-seq Application:

    • Adapt the ac4C LACE-seq method developed for NAT10 to study potential NAT14-mediated RNA modifications

    • Compare modification patterns between NAT10 and NAT14

    • Identify unique and overlapping targets

  • Functional Consequence Investigation:

    • Examine effects on RNA stability, translation efficiency, and subcellular localization

    • Use ribosome profiling to assess impact on translation

    • Create knockout models to determine physiological relevance

This comparative approach would help determine whether NAT14 has a complementary or distinct role in RNA modification compared to the well-characterized NAT10.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.