Recombinant Bovine N-arachidonyl glycine receptor (GPR18)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant bovine GPR18 is primarily utilized to study ligand-receptor interactions, signaling pathways, and structural biology. Key applications include:

Functional Assays

  • Calcium Mobilization: Screening for ligands using intracellular Ca²⁺ flux measurements, as demonstrated in heterologous systems .

  • cAMP Inhibition: Pertussis toxin-sensitive inhibition of forskolin-induced cAMP production .

  • Migration Studies: Investigating receptor-mediated chemotaxis in immune cells .

Therapeutic Research

  • Neuroprotection: NAGly-GPR18 signaling reduces neuronal damage in excitotoxicity models, potentially via modulation of microglial and astrocyte activity .

  • Immune Regulation: GPR18 activation promotes resolution of inflammation, as seen in sepsis and peritonitis models .

Ligand Specificity

  • Primary Ligand: NAGly binds GPR18 with high affinity, inducing Ca²⁺ mobilization and inhibiting cAMP in a Gαi/o-dependent manner .

  • Cannabinoid Cross-Reactivity: Anandamide and abnormal cannabidiol (Abn-Cbd) also activate GPR18, though signaling outcomes vary across species .

Controversies in Signaling

  • Biased Signaling: NAGly activates Gαi/o pathways but fails to recruit β-arrestin, suggesting biased agonism .

  • Constitutive Activity: Bovine GPR18 exhibits rapid constitutive trafficking in heterologous systems, complicating ligand-response detection .

PathwayEffect of NAGlyReferences
cAMP InhibitionPertussis toxin-sensitive (IC₅₀: 20 nM)
Ca²⁺ FluxIncreased in transfected cells
ERK PhosphorylationNo consistent activation observed

Challenges in Characterization

  • Species-Specific Variability: Bovine GPR18 shares ~85% sequence identity with human orthologs, but ligand efficacy differs significantly .

  • Low Surface Expression: Intracellular retention in stable cell lines necessitates transient transfection for functional studies .

Future Directions

  • Drug Development: Targeting GPR18 for inflammatory, neurodegenerative, or metabolic disorders .

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing it accordingly.
Synonyms
GPR18; N-arachidonyl glycine receptor; NAGly receptor; G-protein coupled receptor 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MTTPHSQAQPGLPIDPHPDEYKVAALVFYSCIFIIGLFVNVTALWVFSCTTKKRTTVTVY MMNVALLDLVFIMSLPFRMLYYAKGEWPFGEYFCRILGALTVFYPSIALWLLAFISADRY MAIVQPKYAKELKNTCKAVMACVGVWIMTLTTTIPLLLLYEDPDTASSTPPTCLKISDII YLKAINALNFTRLIFFFLIPLFIMIGCYLVIIHSLLHGKTSKLKPKVKEKSIRIIITLMV QVLVCFMPFHICFAFLMLGGDENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVIS VMLYRNYLRSVRRKSFRSGSLRSLSNINSEML
Uniprot No.

Target Background

Function
This protein serves as the receptor for the endocannabinoid N-arachidonyl glycine (NAGly). However, conflicting results regarding NAGly's role as an agonist have been reported. It can also be activated by plant-derived and synthetic cannabinoid agonists. The receptor's activity is mediated by G proteins that inhibit adenylyl cyclase. It may contribute to the regulation of the immune system. This receptor is crucial for maintaining the normal homeostasis of CD8+ subsets of intraepithelial lymphocytes (IELs) (CD8alphaalpha and CD8alphabeta IELs) in the small intestine. It facilitates preferential migration of CD8alphaalpha T-cells to the intraepithelial compartment over the lamina propria compartment, and it plays a role in their reconstitution into the small intestine after bone marrow transplant. This receptor participates in hypotensive responses, mediating a reduction in intraocular and blood pressure. It mediates NAGly-induced reorganization of actin filaments and the induction of acrosomal exocytosis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.

Q&A

What is GPR18 and how is it classified within the GPCR family?

GPR18 is a G-protein-coupled receptor that belongs to the orphan class A family. Despite sharing low sequence homology with cannabinoid receptors CB1R and CB2R, research suggests it may be functionally related to the endocannabinoid system. This relationship is supported by GPR18's ability to interact with certain cannabinoid ligands and its potential to form heteromers with cannabinoid receptors . GPR18 has attracted research interest for potential therapeutic applications including regulation of intraocular pressure, cancer treatment, and immune system modulation .

Where is GPR18 predominantly expressed in mammalian tissues?

GPR18 exhibits a tissue-specific expression pattern with highest mRNA levels detected in:

  • Testis

  • Spleen

  • Lymph nodes

  • Peripheral blood leukocytes

At the cellular level, GPR18 shows particularly strong expression in:

  • CD8αα intraepithelial lymphocytes (high expression)

  • CD8+ T cells (considerable expression)

  • CD4+ T cells (moderate expression)

  • Human T-Cell lymphotrophic virus-transformed cell lines

  • Phytohaemagglutinin-activated CD4+ T-cells (very high expression)

Within T cell populations, GPR18 expression is maintained in both CD44hi CD62Llo effector memory and CD44hi CD62Lhi central memory CD8 T cells . Some research has suggested microglial expression, but this finding has been inconsistently replicated across studies .

What is the current evidence regarding N-arachidonyl glycine as a potential endogenous ligand for GPR18?

The status of N-arachidonyl glycine (NAGly) as an endogenous ligand for GPR18 remains controversial with contradictory experimental findings:

Supporting evidence:

  • NAGly (10 μM) was identified as a hit in a bioactive lipid screen using cells stably expressing human GPR18, where it induced calcium flux

Contradictory evidence:

  • A high-throughput β-arrestin-based screen failed to detect activation of GPR18 by NAGly

  • Studies in rat sympathetic neurons expressing GPR18 suggest "NAGly is not an agonist for GPR18 or that GPR18 signaling involves noncanonical pathways not examined in these studies"

  • Human glioblastoma cell lines endogenously expressing GPR18 showed no response to 10 μM NAGly treatment, despite responding to cannabinoid receptor ligands

These contradictions highlight the complexity of GPR18 pharmacology and suggest that: (1) NAGly may activate GPR18 only in specific cellular contexts, (2) GPR18 might signal through pathways not captured in certain experimental systems, or (3) NAGly may not be a universal GPR18 ligand.

What experimental systems are most appropriate for studying GPR18 function?

The search for reliable experimental systems to study GPR18 has proven challenging. Several approaches have been employed with varying success:

Heterologous expression systems:

  • HEK cells: Commonly used but with inconsistent results; some researchers reported "disappointing inability to reproduce published studies on HEK cells expressing hGPR18"

  • Rat sympathetic neurons: Used to investigate GPR18 in "a native neuronal system with endogenous signaling pathways and effectors"

  • L929 cells: Mouse connective tissue cell line used to create stable lines expressing human GPR18

Endogenously expressing cells:

  • Primary human glioblastoma cell lines (NZB11 and NZB19): Express GPR18 mRNA alongside CB1 (but not CB2 or GPR55)

  • Mouse microglial BV-2 cell line and human endometrial HEC-1b cell line: Reported to express functional GPR18 in some studies, but GPR18 mRNA was undetectable in others

In vivo models:

  • GPR18 knockout (Gpr18−/−) mice: Exhibit phenotypes particularly in CD8+ T cell populations, providing a valuable system for studying GPR18 function

  • Competitive bone marrow chimeras: Created by reconstituting mice with mixtures of wild-type and GPR18-deficient bone marrow to determine cell-intrinsic effects

The inconsistent results across different experimental systems highlight the importance of using multiple approaches and carefully selecting appropriate models for GPR18 research.

How can researchers validate potential GPR18 ligands given the conflicting literature?

Due to conflicting reports about GPR18 pharmacology, a comprehensive multi-faceted approach is recommended for ligand validation:

  • Multiple functional readouts:

    • Calcium flux assays

    • MAP kinase and Akt phosphorylation

    • N-type calcium channel modulation

    • β-arrestin recruitment (though this has produced negative results for some ligands)

    • Effects on inflammatory mediator production (e.g., reactive oxygen intermediates, nitric oxide, TNF-α)

  • Pathway verification:

    • Pertussis toxin (PTX) sensitivity: GPR18 appears to couple to Gi/o proteins, so PTX blockade of effects supports GPR18 involvement

    • Examination of downstream effectors specific to GPR18 signaling

  • Genetic approaches:

    • Comparison of ligand effects in wild-type versus GPR18-knockout systems

    • Rescue experiments with GPR18 re-expression in knockout backgrounds

  • Structure-guided methods:

    • Virtual screening using validated homology models of GPR18

    • Structure-activity relationship (SAR) studies of potential ligands

  • Cross-validation in multiple systems:

    • Testing in both heterologous expression systems and cells naturally expressing GPR18

    • Comparison of in vitro and in vivo effects

The contradictory nature of GPR18 pharmacology necessitates this comprehensive approach to confidently identify and validate ligands.

What signaling pathways have been associated with GPR18 activation?

GPR18 signaling remains incompletely characterized, with evidence suggesting involvement of several pathways:

G protein coupling:

  • Evidence suggests coupling to Gαi/o proteins, as responses to putative GPR18 ligands show sensitivity to pertussis toxin

Downstream effectors:

  • Phosphorylation of p44/42 mitogen-activated protein (MAP) kinase

  • Activation of protein kinase B/Akt

  • Calcium mobilization (in some but not all studies)

Functional outcomes in specific cell types:

  • In endothelial cells: Activation of pathways involved in cell migration

  • In immune cells: Modulation of inflammatory responses, including:

    • Suppression of reactive oxygen intermediate production

    • Inhibition of LPS-induced nitric oxide production

    • Reduction of TNF-α production

The possibility of non-canonical signaling has been proposed to explain some conflicting experimental results, suggesting GPR18 may utilize pathways beyond those typically examined in GPCR screening assays .

What is the functional significance of GPR18 in the immune system?

GPR18 plays a critical role in shaping immune cell populations, with particularly strong effects on CD8+ T cells:

Effects on CD8+ T cell populations:

  • GPR18 knockout mice exhibit reduced frequencies of CD44hi CD62Llo effector memory CD8 T cells

  • Particularly strong deficiency in KLRG1+ cells within the CD8 effector memory compartment

  • This phenotype becomes more pronounced with age (more severe in 6-month-old vs. 2-month-old mice)

Cell-intrinsic mechanism:

  • Competitive bone marrow chimera experiments demonstrate that GPR18-deficient CD8 T cells fail to generate normal frequencies of KLRG1+ effector memory cells even when developing alongside wild-type cells

  • Retroviral transduction of GPR18 into GPR18-deficient bone marrow cells restores normal levels of CD8 effector memory and KLRG1+ cells

Molecular markers affected:

  • GPR18-deficient CD8 effector memory cells show reduced expression of Granzyme B, a cytotoxic mediator

  • T-bet (Tbx21) expression is maintained in the remaining KLRG1+ cells, suggesting GPR18 acts downstream of or parallel to T-bet

Specificity of immune effects:

  • No significant alterations in CD4 T cell populations

  • Naive and central memory CD8 T cell frequencies are unaffected

Table 1: Key Phenotypes in GPR18-Deficient Mice

Cell PopulationEffect of GPR18 DeficiencyAge DependencyMarkers Affected
CD8 effector memory (EM) cellsReduction in frequencyMore pronounced in 6-month vs. 2-month miceCD44hi CD62Llo
KLRG1+ CD8 EM cellsStrong deficiencyMore pronounced with ageKLRG1, Granzyme B
Naive CD8 T cellsNo significant changeNot applicableCD44lo CD62Lhi
Central memory CD8 T cellsNo significant changeNot applicableCD44hi CD62Lhi
CD4 T cellsNo significant changeNot applicableN/A

These findings establish GPR18 as an important regulator of CD8 effector T cell populations, particularly the KLRG1+ subset with cytotoxic potential.

What approaches have been most successful for modeling the structure of GPR18?

Due to challenges in obtaining experimental structures of GPCRs, computational modeling has been crucial for understanding GPR18 structure. A comprehensive approach has employed multiple complementary methods:

Modeling approaches employed:

  • Template-based homology modeling (the "classical method")

  • Threading methods (identifying structural templates based on fold recognition)

  • Ab initio modeling using RoseTTAFold and trRosetta

  • AlphaFold2-generated models as reference standards

Model selection and refinement:

  • From a larger initial set, 15 homologous models were selected for optimization:

    • 3 structures from classical homology modeling

    • 4 models generated using threading methods

    • 7 models from ab initio approaches

    • 1 AlphaFold2 reference model

  • Selected models underwent geometric and energy optimization processes

Evaluation criteria:

  • Numerical quality parameters (C-score, Ramachandran plot statistics)

  • Visual assessment of structural features

  • Functional evaluation through enrichment tests measuring ability to recognize known active ligands

The most reliable GPR18 models were those that performed well across all evaluation metrics, particularly those demonstrating the ability to recognize ligands in virtual screening assays. The inclusion of AlphaFold2 models represents the cutting edge of structure prediction approaches for this challenging receptor.

How can structural models of GPR18 be leveraged for drug discovery?

Validated structural models of GPR18 provide valuable tools for structure-based drug discovery approaches:

Applications of GPR18 structural models:

  • Virtual screening campaigns:

    • Docking of compound libraries to identify potential ligands

    • Enrichment of active compounds from diverse chemical libraries

  • Binding site characterization:

    • Identification of key residues involved in ligand recognition

    • Understanding the molecular basis for ligand selectivity

  • Structure-activity relationship studies:

    • Rational design of derivatives based on known ligands

    • Optimization of ligand properties (potency, selectivity, physicochemical characteristics)

  • Allosteric modulator discovery:

    • Identification of binding sites distinct from the orthosteric site

    • Design of compounds that modify receptor function without competing with endogenous ligands

  • Investigation of receptor dynamics:

    • Molecular dynamics simulations to understand conformational changes

    • Prediction of activation mechanisms

For maximum reliability, drug discovery campaigns should utilize consensus results from multiple high-quality models rather than relying on a single structural prediction, particularly given the challenges in modeling GPCRs accurately.

How can researchers address the contradictory findings regarding GPR18 pharmacology?

The contradictory findings in GPR18 research represent a significant challenge requiring systematic investigation:

Strategies to address contradictions:

  • Standardized experimental protocols:

    • Development of consensus assay systems and conditions

    • Detailed reporting of methodological parameters

    • Multi-laboratory validation studies

  • Comprehensive pharmacological profiling:

    • Testing putative ligands across multiple functional assays

    • Dose-response relationships rather than single-concentration tests

    • Examination of receptor residence time and signaling kinetics

  • Consideration of cellular context:

    • Investigation of required cofactors or interacting proteins

    • Evaluation of receptor expression levels and localization

    • Assessment of signaling machinery present in different cell types

  • Genetic approaches:

    • CRISPR-based receptor knockout and rescue experiments

    • Point mutations to identify critical residues for ligand interaction

    • Chimeric receptor studies to delineate functional domains

  • Investigation of receptor heterogeneity:

    • Post-translational modifications affecting ligand binding or signaling

    • Alternative splicing variants with different pharmacological profiles

    • Species differences in receptor structure and function

By systematically addressing these factors, researchers may resolve current contradictions and develop a more coherent understanding of GPR18 pharmacology.

What are the most promising therapeutic applications for GPR18 modulation?

Based on current knowledge of GPR18 biology, several therapeutic avenues warrant investigation:

Potential therapeutic applications:

  • Immune system modulation:

    • The critical role of GPR18 in CD8+ effector memory T cell populations suggests potential for immunotherapeutic applications

    • GPR18 ligands might enhance cytotoxic T cell responses in cancer immunotherapy

    • Alternatively, GPR18 antagonists might dampen inappropriate CD8+ T cell responses in autoimmunity

  • Anti-inflammatory applications:

    • GPR18 activation has been shown to suppress production of inflammatory mediators including:

      • Reactive oxygen intermediates

      • Nitric oxide

      • TNF-α

    • This suggests potential utility in inflammatory conditions

  • Regulation of intraocular pressure:

    • GPR18 has been implicated in the regulation of intraocular pressure

    • This suggests potential applications in glaucoma treatment

  • Cancer therapies:

    • GPR18 has been identified as a subject of research interest for cancer applications

    • The specific mechanisms warrant further investigation

  • Endothelial cell functions:

    • GPR18 activation stimulates pathways involved in endothelial cell migration

    • This suggests potential roles in angiogenesis, wound healing, or vascular repair

Advancing these therapeutic applications will require resolving current contradictions in GPR18 pharmacology and developing reliable, selective modulators of receptor function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.