Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

What is NDUFA11 and what is its role in mitochondrial function?

NDUFA11 is a supernumerary membrane subunit of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex, which constitutes part of Complex I in the mitochondrial respiratory chain. Research with human NDUFA11 demonstrates its crucial role in Complex I assembly and maintenance. When NDUFA11 expression is suppressed, cellular oxygen consumption linked to Complex I is reduced by approximately two-thirds, indicating its essential function in respiratory chain activity .

The protein appears to have characteristics of both a structural component and an assembly factor for Complex I. Current evidence suggests NDUFA11 participates specifically in constructing the membrane arm of the complex . To assess NDUFA11's role experimentally, researchers typically measure oxygen consumption using high-resolution respirometry, comparing wild-type cells to those with suppressed NDUFA11 expression.

What is the amino acid sequence and structure of NDUFA11?

Based on human NDUFA11 data, the full mature protein spans amino acids 2-141 with the following sequence:

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASSLVKMGRLEGWEVFAKPKV

Bovine NDUFA11 would be expected to show high sequence conservation due to the essential nature of mitochondrial proteins across mammalian species. For structural characterization of bovine NDUFA11, researchers should consider:

• Circular dichroism spectroscopy for secondary structure analysis

• Hydropathy plot analysis to identify potential membrane-spanning regions

• Homology modeling based on human NDUFA11 structural data

• Mass spectrometry for identification of post-translational modifications

How is recombinant bovine NDUFA11 typically produced for research applications?

While the search results specifically address human NDUFA11 production, similar methods can be applied for recombinant bovine NDUFA11:

• Gene cloning: The bovine NDUFA11 coding sequence should be cloned into an appropriate expression vector with an N-terminal His-tag or other purification tag.

• Expression system: E. coli is commonly used for production, as demonstrated with human NDUFA11 . The protein can be expressed as the full-length mature form (amino acids 2-141).

• Purification protocol:

  • Affinity chromatography using the His-tag

  • Size exclusion chromatography for further purification

  • Quality assessment by SDS-PAGE (purity >90% is standard)

• Storage and handling:

  • Lyophilized powder form is recommended for long-term stability

  • Store at -20°C/-80°C

  • Aliquot to prevent repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water (0.1-1.0 mg/mL)

  • Add 5-50% glycerol for long-term storage

What experimental approaches can be used to study NDUFA11's role in Complex I assembly?

Several sophisticated techniques have been employed to investigate NDUFA11's assembly function:

• Gene suppression techniques: RNAi or CRISPR-Cas9 to reduce NDUFA11 expression, followed by assessment of Complex I assembly and function .

• Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique allows visualization of intact respiratory complexes and subcomplexes. When NDUFA11 expression is suppressed, researchers observed accumulation of subcomplexes with molecular masses of 815 and 550 kDa, indicating specific assembly blockage points .

• Stable Isotope Labeling with Amino acids in Cell culture (SILAC): This quantitative proteomics approach has been valuable for identifying proteins associated with NDUFA11-deficient subcomplexes. The protocol involves:

  • Growing control cells in "light" medium and NDUFA11-suppressed cells in "heavy" medium containing isotope-labeled amino acids

  • Creating a 1:1 mixture of immunopurified Complex I from both conditions

  • Analyzing by mass spectrometry to identify differentially abundant proteins

• Mitochondrial localization studies: Colocalization experiments with MitoTracker can confirm mitochondrial localization of NDUFA11 and potential interacting proteins .

• Proximity labeling: Methods like BioID or APEX can identify proteins in close proximity to NDUFA11 during the assembly process.

How does NDUFA11 suppression affect mitochondrial morphology and function?

Studies of NDUFA11 suppression reveal multiple consequences for mitochondrial biology:

• Respiratory chain dysfunction: Cellular oxygen consumption linked to Complex I decreases by approximately two-thirds, although this defect can be bypassed by providing the Complex III substrate duroquinol .

• Mitochondrial network fragmentation: The normal interconnected mitochondrial network becomes fragmented when NDUFA11 is suppressed, suggesting a link between Complex I integrity and mitochondrial dynamics .

• Complex I assembly defects: The amount of intact Complex I decreases, with accumulation of specific subcomplexes (815 and 550 kDa), indicating blocked assembly at particular steps .

• Potential lifespan effects: Interestingly, continuous application of nduf-11(RNAi) in C. elegans extended lifespan compared to control animals, suggesting complex relationships between mitochondrial function and longevity .

What is the significance of the subcomplexes that accumulate when NDUFA11 is suppressed?

The accumulation of specific subcomplexes (815 kDa and 550 kDa) when NDUFA11 is suppressed provides crucial insights into Complex I assembly pathways:

For researchers studying bovine NDUFA11, characterizing these subcomplexes through BN-PAGE followed by Western blotting or mass spectrometry would provide valuable insights into conserved assembly mechanisms.

How does NDUFA11 interact with other assembly factors during Complex I biogenesis?

NDUFA11 appears to function in concert with several other proteins during Complex I assembly:

To investigate these interactions in bovine models, researchers could employ:

• Co-immunoprecipitation studies to detect direct protein-protein interactions

• Proximity ligation assays to visualize interactions in situ

• Crosslinking mass spectrometry to map interaction interfaces

• Sequential depletion experiments to establish assembly factor hierarchies

How can experimental design principles be applied to investigate NDUFA11 mutations?

When designing experiments to study NDUFA11 mutations, researchers should consider several key principles of experimental design :

• Control implementation: Include appropriate controls such as wild-type NDUFA11, empty vector controls, and rescue experiments with wild-type NDUFA11 to confirm specificity .

• Variable manipulation: Systematically manipulate independent variables (e.g., specific NDUFA11 mutations or expression levels) while measuring dependent variables (oxygen consumption, Complex I assembly) .

• Knockdown approach selection: Complete knockout might be lethal, so conditional or partial suppression may be necessary . Options include:

  • Inducible RNAi systems

  • CRISPR-Cas9 with conditional alleles

  • Hypomorphic mutations

• Multi-parameter assessment: Employ multiple complementary assays to evaluate Complex I function:

  • Oxygen consumption measurements

  • Complex I enzymatic activity assays

  • BN-PAGE for assembly analysis

  • ATP production

  • Mitochondrial membrane potential

  • ROS production

• Temporal considerations: Design time-course experiments to distinguish between acute and chronic effects of NDUFA11 deficiency .

• Statistical rigor: Ensure adequate replication and appropriate statistical analysis to establish significance of findings .

What methodologies can distinguish between NDUFA11's structural and assembly factor roles?

NDUFA11 appears to have dual functions as both a structural component of Complex I and as an assembly factor . To differentiate these roles, researchers could:

• Temporal incorporation analysis: Track NDUFA11 incorporation during Complex I assembly using pulse-chase labeling to determine if it remains in the mature complex or dissociates after assembly.

• Structure-function mutations: Create mutant versions of NDUFA11 that specifically disrupt either structural integrity or interactions with assembly factors:

  • Point mutations in potential interaction domains

  • Truncation mutants to remove specific functional regions

  • Chimeric proteins swapping domains with homologs

• Interaction profiling: Compare NDUFA11's interaction partners in mature Complex I versus assembly intermediates using:

  • BioID or APEX proximity labeling

  • Stage-specific immunoprecipitation

  • Crosslinking mass spectrometry

• Quantitative stoichiometry: Determine if NDUFA11 is present in stoichiometric amounts in mature Complex I (suggesting a structural role) or substoichiometric amounts (suggesting a transient assembly factor role).

• Domain-specific antibodies: Generate antibodies against different domains of NDUFA11 to track structural changes during the transition from assembly factor to structural component.