Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine NADH Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 11, Mitochondrial (NDUFB11)

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11), is a recombinant protein produced using an in vitro E. coli expression system . This protein is a subunit of the mitochondrial respiratory chain complex I, which plays a crucial role in the electron transport process and energy metabolism within cells . NDUFB11 is involved in the assembly and stability of complex I, contributing to mitochondrial function and oxidative stress response .

Biological Function of NDUFB11

NDUFB11 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), believed not to be directly involved in catalysis but essential for complex stability and assembly . It is part of the 30 supernumerary subunits of complex I, which may participate in complex stabilization, protection against oxidative stress, assembly, and regulation of complex activity .

Production and Availability

The recombinant bovine NDUFB11 is produced in an E. coli expression system, allowing for controlled and efficient production of the protein for research purposes . This recombinant form is useful for studying the biological functions of NDUFB11 and its role in mitochondrial diseases.

Research Findings and Applications

Recent studies have highlighted the role of NDUFB11 in various diseases, including atherosclerosis and chronic stress, where its underexpression is associated with worse prognosis . Additionally, mutations in NDUFB11 have been linked to mitochondrial disorders, such as NDUFB11 deficient mitochondriopathy, characterized by muscle weakness, neurological disorders, and metabolic issues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
NDUFB11; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; Complex I-ESSS; CI-ESSS; NADH-ubiquinone oxidoreductase ESSS subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-154
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDIWNMRV VFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPIMESNCFDPSKIQL PEDED
Uniprot No.

Target Background

Function
Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed not to be directly involved in catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.
Gene References Into Functions
  1. The ESSS subunit lacks a known role in the assembly of complex I's hydrophobic subunits encoded within the mitochondrial genome. PMID: 15056672
Database Links

KEGG: bta:404161

STRING: 9913.ENSBTAP00000055738

UniGene: Bt.6494

Protein Families
Complex I NDUFB11 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and localization of NDUFB11 within mitochondrial complex I?

NDUFB11 (also known as ESSS or neuronal protein 17.3) is a 153-amino acid protein that functions as a supernumerary subunit of mitochondrial respiratory chain complex I. Unlike core subunits, NDUFB11 contains a single transmembrane helical domain (residues 81-109) . In the resolved molecular structure of bovine complex I, the bovine homolog of human NDUFB11 is located parallel to the membrane on the intermembrane space (IMS) face, spanning the ND4 and ND5 modules . The transmembrane domain contributes to hydrophobicity and membrane anchoring, with phenylalanine 93 being particularly important for structural integrity . When this residue is deleted (as in the p.F93del mutation), it causes shortening of the transmembrane domain and rotational rearrangement of succeeding residues, potentially affecting membrane localization and protein interactions .

How does bovine NDUFB11 compare structurally to human NDUFB11?

Bovine NDUFB11 maintains high sequence homology with human NDUFB11, particularly in the transmembrane domain and functional regions. The calculated molecular weight of human NDUFB11 is 18 kDa (163 amino acids), with observed molecular weight on gel electrophoresis of 18-20 kDa . The bovine protein shares this characteristic molecular weight range. Both proteins maintain the critical single transmembrane domain and contribute similarly to complex I assembly. Recombinant bovine NDUFB11 can be used as a model for studying human NDUFB11 function due to this high conservation, though species-specific post-translational modifications may exist .

What is the role of NDUFB11 in complex I assembly and function?

NDUFB11 plays a critical role in complex I assembly and stability rather than directly participating in electron transfer catalysis. Research using shRNA-mediated knockdown has demonstrated that NDUFB11 is essential for:

  • Complex I assembly and maintenance of holocomplex structure

  • Complex I enzymatic activity

  • Cell growth and survival
    NDUFB11 deficiency results in the formation of multiple subassembly complexes, similar to defects in other accessory subunits of the P-D unit of complex I. This leads to decreased complex I enzyme activity and disruption of energy metabolism . Unlike core subunits involved in direct electron transfer, NDUFB11 likely serves as a structural component that helps stabilize the complex and protect it against oxidative stress .

What are the optimal conditions for expressing and purifying recombinant bovine NDUFB11?

For successful expression and purification of recombinant bovine NDUFB11, researchers should consider the following methodological approach:
Expression System Selection:

  • Mammalian expression systems (HEK293 or CHO cells) are preferred for proper post-translational modifications

  • Bacterial systems (E. coli) may be used with codon optimization, but will lack post-translational modifications

  • Insect cell systems (Sf9) offer a compromise between yield and modification fidelity
    Purification Protocol:

  • Use affinity purification with N-terminal or C-terminal tags (His6 or GST)

  • Include 0.1-0.5% mild detergent (DDM or CHAPS) in buffers to maintain protein solubility

  • Perform size exclusion chromatography to obtain homogeneous protein

  • Store in PBS with 0.02% sodium azide and 50% glycerol at pH 7.3 for maximum stability
    Critical Parameters:

  • Maintain temperature at 4°C throughout purification

  • Include protease inhibitors to prevent degradation

  • Consider co-expression with other complex I subunits for improved stability
    The recombinant protein can be stored at -20°C and remains stable for approximately one year after production. Aliquoting is unnecessary for -20°C storage .

What validation techniques are most effective for confirming NDUFB11 expression and activity?

Multiple complementary techniques should be employed to validate recombinant NDUFB11 expression and functional activity:

TechniqueApplicationRecommended Dilution/ConditionExpected Results
Western Blot (WB)Protein expression confirmation1:1000-1:400018-20 kDa band
Immunoprecipitation (IP)Protein-protein interactions0.5-4.0 μg for 1.0-3.0 mg total proteinSuccessful pull-down of NDUFB11 and interacting partners
Immunofluorescence (IF)Cellular localization1:50-1:500Mitochondrial localization pattern
Complex I Activity AssayFunctional validationNADH:ubiquinone oxidoreductase activityEnhanced activity with functional NDUFB11
Blue Native PAGEComplex I assemblySequential immunoblottingIncorporation into ~980 kDa complex I
Seahorse XF AnalyzerCellular respirationMitochondrial Stress Test kitIncreased basal respiration and ATP production
For functional validation, measuring respiratory capacity using the Seahorse XF96 Extracellular Flux Analyzer with the Mitochondrial Stress Test kit provides comprehensive data on how the recombinant NDUFB11 affects basal respiration, ATP production, and respiratory capacity .

How can CRISPR/Cas9 genome editing be optimized for studying NDUFB11 function in cell models?

When applying CRISPR/Cas9 technology to study NDUFB11 function:
Guide RNA Design:

  • Target conserved regions between bovine and human NDUFB11 for translational relevance

  • Design guides with minimal off-target effects (use tools like CRISPOR or Benchling)

  • Include PAM site selection optimized for high editing efficiency
    Experimental Protocol:

  • Transfect cells with CRISPR/Cas9/GFP plasmid containing the NDUFB11-targeting guide sequence

  • Provide single-stranded homologous recombination oligo donor sequence for precise mutations

  • Sort GFP-positive cells via FACS 48 hours post-transfection

  • Identify correctly targeted clones using restriction enzyme digestion (e.g., HinfI digestion of PCR products spanning the target site)

  • Confirm edits by Sanger sequencing
    Validation Methods:

  • Perform phenotypic assays including o-dianisidine staining for hemoglobinization in erythroid models

  • Measure complex I assembly using blue native gel electrophoresis with antibodies against multiple complex I subunits

  • Assess cell viability and proliferation, as NDUFB11 knockdown affects cell growth
    A particular challenge is the potential lethality of complete NDUFB11 knockout. Consider using inducible systems or heterozygous mutations to overcome this limitation.

How does recombinant NDUFB11 expression affect mitochondrial function in models of respiratory chain disorders?

Recombinant NDUFB11 expression in cellular models of respiratory chain disorders demonstrates several significant effects:
Rescue Effects in Deficient Models:

  • Restoration of complex I assembly: Reintroduction of wild-type NDUFB11 in deficient cells restores the formation of holocomplex I, particularly stabilizing the ND4 and ND5 modules

  • Recovery of electron transport: Expression normalizes electron flow through the respiratory chain, improving NADH:ubiquinone oxidoreductase activity

  • Improved cellular bioenergetics: ATP production increases by approximately 30-50% depending on the cell type and severity of deficiency
    Pathogenic Mutation Models:
    When modeling specific mutations (like p.F93del), researchers have observed:

  • Respiratory insufficiency: Decreased oxygen consumption rate and extracellular acidification rate

  • Assembly defects: Formation of subassembly complexes rather than complete complex I

  • Cell-type specific effects: Particularly strong proliferation defects in erythroid lineage cells with minimal impact on differentiation potential
    These findings suggest that NDUFB11 primarily affects cell types with high energy demands through disruption of mitochondrial energy production rather than through developmental signaling pathways.

What is the relationship between NDUFB11 expression and atherosclerosis or chronic stress?

Recent research has identified an underexpression of NDUFB11 in atherosclerosis and chronic stress conditions. The relationship appears to be bidirectional:
Observed Correlations:

  • NDUFB11 expression levels are significantly lower in atherosclerotic plaques compared to normal arterial tissue

  • Chronic stress models show reduced NDUFB11 expression in cardiac and vascular tissues

  • Lower NDUFB11 expression correlates with worse prognosis in cardiovascular disease patients
    Mechanistic Insights:
    NDUFB11 underexpression in these conditions affects:

  • Mitochondrial energy metabolism in vascular smooth muscle cells and cardiomyocytes

  • Oxidative stress responses, with increased ROS production

  • Cellular resilience to metabolic challenges

  • Inflammatory signaling pathways that contribute to atherosclerotic progression
    These findings position NDUFB11 as a potential molecular target for precision treatment approaches in atherosclerosis and stress-related cardiovascular conditions. Recombinant NDUFB11 supplementation or gene therapy approaches targeting NDUFB11 expression represent promising research directions .

How do NDUFB11 mutations contribute to the diverse clinical presentations of NDUFB11-related disorders?

NDUFB11 mutations lead to remarkably diverse clinical presentations, reflecting the protein's central role in mitochondrial function across multiple tissues:
Clinical-Molecular Correlations:

Clinical PresentationMolecular MechanismAffected TissuesResearch Model Findings
Sideroblastic anemiaImpaired erythroid proliferation with preserved differentiationBone marrow, erythroid precursorsK562 cells with p.F93del mutation show proliferation defects but can still undergo hemoglobinization
Linear skin defectsDisrupted development of skin progenitorsFacial/scalp epidermisCell migration and mitochondrial dysfunction in epithelial cultures
Histiocytoid cardiomyopathyEnergy deficiency in cardiomyocytesCardiac muscleReduced complex I activity and increased apoptosis in cardiac models
Mitochondrial complex I deficiencyGlobal energy production disruptionBrain, muscle, liver, kidneyDecreased ATP synthesis and increased ROS production in fibroblasts
The varying tissue sensitivity to NDUFB11 dysfunction likely reflects differences in:
  • Energy demands and dependency on oxidative phosphorylation

  • Compensatory mechanisms for complex I deficiency

  • Developmental timing of critical energy requirements

  • Tissue-specific NDUFB11 interaction partners
    This diversity highlights the importance of studying NDUFB11 function across multiple cell types and developmental stages to understand its tissue-specific roles.

How does the loss of NDUFB11 affect complex I assembly intermediates and integration with other respiratory complexes?

The loss of NDUFB11 creates a complex cascade of effects on respiratory chain organization:
Complex I Assembly Dynamics:
When NDUFB11 is absent, multiple subassembly complexes form instead of complete complex I. Research using blue native gel electrophoresis with antibodies against NDUFS2, NDUFS3, NDUFS4, NDUFB6, NDUFS5, NDUFA2, and MTND1 has revealed:

  • Accumulation of the ~550 kDa Q/PP-a intermediate lacking the distal P module

  • Defective incorporation of ND4 and ND5 modules into the holoenzyme

  • Destabilization of the membrane arm of complex I
    Respiratory Supercomplex Formation:
    NDUFB11 deficiency also disrupts the formation of respiratory supercomplexes (respirasomes):

  • Reduced association between complex I and complex III

  • Altered electron channeling between complexes

  • Disrupted cristae organization that normally supports supercomplex assembly
    These findings indicate that NDUFB11's role extends beyond complex I itself to the higher-order organization of the respiratory chain, with implications for understanding mitochondrial dysfunction in disease states.

What are the mechanisms by which NDUFB11 is imported and oxidized by CHCHD4 in the intermembrane space?

NDUFB11 follows an atypical pathway for import and oxidation in the intermembrane space:
Import Pathway:
Unlike most complex I subunits, NDUFB11 contains atypical twin CX₆C/CX₁₁C motifs that serve as targets for the mitochondrial intermembrane space import and assembly (MIA) pathway. The process involves:

  • Recognition of the CHCHD4-recognition motif in NDUFB11 (an α-helix with a hydrophobic face containing a cysteine residue)

  • Translocation across the outer mitochondrial membrane in a reduced state

  • Oxidation by CHCHD4 (Mia40 in yeast) in the intermembrane space

  • Formation of disulfide bonds between consecutive cysteines within each motif rather than between motifs
    This process differs from typical twin CX₃C and CX₉C proteins where disulfides form between motifs. NDUFB11 shares this pathway with three other complex I proteins (NDUFA8, NDUFB7, and NDUFS5) that line the intermembrane space face of complex I, suggesting they function as "clamps" that hold together individual complex I modules .
    The unique import pathway of NDUFB11 provides potential therapeutic targets for modulating complex I assembly in mitochondrial diseases.

How do sex-specific expression patterns of NDUFB11 impact its use as a housekeeping gene in research?

The X-linked nature of NDUFB11 creates important sex-specific considerations for researchers:
Sex Bias in Expression:
Recent computational analyses of massive datasets have revealed that NDUFB11 exhibits sex-biased expression patterns:

  • NDUFB11 shows stable expression in females but variable expression in males

  • This contrasts with genes like DDX39B and PLIN4, which are stable in males but not females
    Research Implications:
    These findings have significant methodological implications:

  • Using NDUFB11 as a housekeeping gene for normalization without assessing its behavior under sex-specific experimental conditions may lead to biased outcomes

  • NDUFB11 may remain stable in female samples but show variation in male samples

  • Ignoring sex when selecting NDUFB11 as a reference gene introduces confounding variables that reduce statistical power
    Recommended Approach:
    Researchers should:

  • Assess NDUFB11 stability in both sexes before using it for normalization

  • Consider alternative housekeeping genes when studying mixed-sex samples

  • Report animal sex in all publications to improve reproducibility

  • Validate reference gene stability separately in male and female samples
    This sex-specific variation must be considered when designing experiments involving NDUFB11 and interpreting results from studies using it as a reference gene.

What therapeutic approaches targeting NDUFB11 show promise for mitochondrial disorders?

Several innovative therapeutic approaches targeting NDUFB11 are currently being explored:
Gene Therapy Approaches:

How can single-cell technologies advance our understanding of NDUFB11 function in heterogeneous tissues?

Single-cell technologies offer unprecedented opportunities to understand NDUFB11 function:
Single-Cell Applications:

  • Single-cell RNA sequencing can reveal cell-type-specific expression patterns of NDUFB11 and compensatory responses to its dysfunction

  • Single-cell proteomics can identify variation in NDUFB11 protein levels and post-translational modifications

  • Spatial transcriptomics can map NDUFB11 expression in tissue context, particularly important for understanding its role in skin defects and cardiac abnormalities
    Research Opportunities:

  • Mapping cell-specific vulnerabilities to NDUFB11 deficiency

  • Identifying compensatory pathways in resistant cell populations

  • Understanding the progression of pathology at single-cell resolution

  • Discovering potential cell-specific therapeutic targets
    Methodological Approaches:

  • Integration of single-cell data with tissue-level metabolomics

  • Development of cell-specific reporter systems for NDUFB11 function

  • Application of machine learning to predict cell-type vulnerability based on metabolic profiles
    These approaches will be particularly valuable for understanding the mosaic effects in female carriers of X-linked NDUFB11 mutations due to random X-inactivation patterns .

What is the role of NDUFB11 in non-canonical functions beyond complex I assembly?

Emerging evidence suggests NDUFB11 has functions beyond its established role in complex I:
Non-Canonical Functions:

  • Mitochondrial Dynamics Regulation:

    • NDUFB11 may interact with proteins involved in mitochondrial fission and fusion

    • Its loss affects mitochondrial network morphology independently of respiratory defects

  • Metabolic Signaling:

    • Potential involvement in retrograde signaling from mitochondria to nucleus

    • Interaction with stress response pathways, particularly relevant to its role in chronic stress conditions

  • Development and Differentiation:

    • Tissue-specific developmental roles evidenced by congenital abnormalities in NDUFB11 disorders

    • Potential role in cellular differentiation pathways, particularly in skin and cardiac tissue

  • Cell Death Regulation:

    • Possible involvement in apoptotic threshold regulation

    • Interaction with cell survival pathways independent of bioenergetic function
      These non-canonical functions may explain why NDUFB11 mutations cause specific developmental phenotypes rather than just generalized energy deficiency syndromes . Future research combining proteomics, metabolomics, and developmental biology approaches will be essential to fully characterize these emerging roles of NDUFB11 beyond complex I assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.