Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
NDUFB4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SFPKYEASRLSSLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYYDPSRRGVIE DPALVRWTYARSANIYPNFRPNTKTSLLGALFGIGPLVFWYYVFKTDRDRKEKLIQEGKL DRTFNISY
Uniprot No.

Target Background

Function

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be non-catalytic. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB4 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is NDUFB4 and what is its fundamental role in mitochondrial function?

NDUFB4 is a critical accessory subunit of mitochondrial complex I (NADH:ubiquinone oxidoreductase) that participates in the formation of respiratory supercomplexes. Research demonstrates that NDUFB4 contains specific residues that interact with the subunit UQCRC1 from complex III, making it integral for I₁III₂IV₁ respirasome integrity and assembly . This interaction is essential for efficient electron transfer in the mitochondrial respiratory chain and subsequent ATP production. The protein functions primarily within the inner mitochondrial membrane, where it helps stabilize the membrane arm of complex I while facilitating interactions with other respiratory complexes.

Unlike core subunits that directly participate in electron transfer, NDUFB4 as an accessory subunit plays crucial roles in structural stability and assembly of functional respiratory complexes. Experimental evidence indicates that ablation of NDUFB4 results in the loss of complex I, III, and IV containing respiratory supercomplexes, highlighting its importance beyond simple structural support .

How can researchers distinguish between properly folded and misfolded recombinant bovine NDUFB4?

Proper folding of recombinant bovine NDUFB4 can be verified through multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: This technique allows assessment of secondary structure elements. Properly folded NDUFB4 will display characteristic α-helical patterns in the CD spectrum due to its transmembrane domain structure.

  • Limited Proteolysis: Correctly folded proteins typically show greater resistance to proteolytic digestion compared to misfolded variants. Researchers can perform time-course limited proteolysis followed by SDS-PAGE analysis to identify protection patterns indicative of proper folding.

  • Functional Reconstitution Assays: The ultimate test involves incorporating recombinant NDUFB4 into liposomes or isolated mitochondrial membranes depleted of native NDUFB4, then measuring recovery of supercomplex formation through Blue Native PAGE analysis .

  • Antibody Recognition: Conformational antibodies that recognize specific epitopes only present in correctly folded NDUFB4 can be used. When performing immunological assays, properly folded protein will show stronger reactivity with these antibodies .

What antibodies are most effective for bovine NDUFB4 detection in different applications?

Based on cross-reactivity patterns observed between species, researchers have successfully employed several antibodies for bovine NDUFB4 detection:

Antibody TypeHostApplicationsSpecies ReactivityRecommended DilutionDetection Sensitivity
PolyclonalRabbitWB, IHC, IFHuman, Cow, Mouse, RatWB (1:500-1:1000), IF (1:50-1:200)~10 ng protein
MonoclonalRabbitWB, IF, ICHuman, CowWB (1:1000), IF (1:100)~5 ng protein
RecombinantRabbitWB, IF, ICHuman, Mouse, Rat, CowWB (1:500-1:1000), IF (1:50-1:200)~1-5 ng protein

For optimal results in bovine studies, antibodies raised against the N-terminal region of NDUFB4 have shown particularly strong cross-reactivity between human and bovine samples . When selecting antibodies for critical experiments, validation through knockout controls is strongly recommended to ensure specificity, as some commercial antibodies may exhibit non-specific binding to other mitochondrial proteins.

What are the most effective techniques for studying NDUFB4's role in respiratory supercomplex assembly?

Several complementary techniques are essential for comprehensive investigation of NDUFB4's role in supercomplex assembly:

  • Blue Native PAGE (BN-PAGE): This technique is the gold standard for analyzing intact respiratory supercomplexes. Digitonin-solubilized membrane proteins can be separated by BN-PAGE followed by immunoblotting with antibodies against NDUFB4 or other supercomplex components like NDUFA9 . This approach allows visualization of different supercomplex populations and assessment of how NDUFB4 mutations or absence affects their formation.

  • CRISPR/Cas9 Gene Editing: Generation of NDUFB4 knockout cell lines followed by rescue experiments with wild-type or mutant NDUFB4 enables direct assessment of specific residues involved in supercomplex formation. This approach was successfully used to demonstrate that mutations at Asn24 and Arg30 of NDUFB4 disrupt supercomplex assembly while minimally affecting complex I integrity .

  • Crosslinking Mass Spectrometry: This technique identifies protein-protein interaction interfaces by chemically crosslinking neighboring proteins followed by mass spectrometric analysis. It can map the precise interaction sites between NDUFB4 and complex III components like UQCRC1.

  • Cryo-Electron Microscopy: High-resolution structural analysis of intact supercomplexes can reveal the precise positioning of NDUFB4 within the respirasome architecture and identify key interaction interfaces.

  • Respirometry Analysis: Functional consequences of NDUFB4 alterations can be measured using oxygen consumption rate (OCR) assays with instruments like Seahorse XF analyzers, which quantify changes in mitochondrial respiratory capacity .

How can researchers effectively produce and purify recombinant bovine NDUFB4?

Production of functional recombinant bovine NDUFB4 presents significant challenges due to its hydrophobic nature and requirement for proper membrane insertion. A multi-step approach has proven most successful:

  • Expression System Selection:

    • Mammalian expression systems (HEK-293 cells) provide proper post-translational modifications and membrane insertion machinery .

    • Insect cell systems (Sf9, High Five) with baculovirus vectors offer higher protein yields while maintaining eukaryotic processing.

    • Bacterial systems typically yield inclusion bodies requiring refolding.

  • Construct Design:

    • Inclusion of a C-terminal purification tag (His6, FLAG) facilitates purification without interfering with N-terminal membrane insertion .

    • Codon optimization for the selected expression system improves translation efficiency.

  • Purification Protocol:

    • Gentle detergent solubilization (digitonin, DDM, or LMNG) preserves protein structure.

    • Two-step purification combining affinity chromatography and size exclusion chromatography.

    • Reconstitution into nanodiscs or liposomes for functional studies.

  • Quality Control:

    • Mass spectrometry verification of protein integrity and post-translational modifications.

    • Circular dichroism to confirm secondary structure.

    • Functional reconstitution assays to verify activity.

What critical residues in bovine NDUFB4 mediate its interaction with complex III?

Based on structural and mutational studies, several key residues in NDUFB4 have been identified as critical for interaction with complex III components, particularly UQCRC1:

ResidueFunctionEffect of MutationConservation Across Species
Asn24 (N24)Forms hydrogen bonds with UQCRC1N24A mutation impairs respirasome assemblyHighly conserved in mammals
Arg30 (R30)Electrostatic interaction with UQCRC1R30A mutation reduces supercomplex formationConserved in bovine and human
Transmembrane domain (aa 15-35)Membrane anchoring and positioningMutations disrupt complex I stabilityHighly conserved sequence

Research has demonstrated that point mutations specifically at Asn24 and Arg30 of NDUFB4 disrupt respirasome formation while minimizing disturbance to complex I integrity . These residues appear to be directly involved in the protein-protein interactions necessary for stable association between complexes I and III. The conservation of these residues between human and bovine NDUFB4 suggests a similar functional role across species.

Experimental approaches using site-directed mutagenesis followed by BN-PAGE analysis have been particularly informative in identifying these critical interaction sites. Specifically, alanine substitutions at these positions (N24A, R30A) demonstrated clear impairment of respiratory supercomplex assembly while preserving the basic structure of complex I .

How does NDUFB4 deficiency impact mitochondrial metabolism and cellular bioenergetics?

NDUFB4 deficiency leads to profound effects on mitochondrial function through multiple interconnected mechanisms:

  • Disrupted Respirasome Assembly: Loss of NDUFB4 results in the disassembly of I₁III₂IV₁ respirasomes, as demonstrated through BN-PAGE analysis of NDUFB4 knockout cells . This disruption compromises efficient electron transfer between complexes.

  • Reduced Respiratory Flux: Studies show that NDUFB4 mutations or deficiency lead to decreased mitochondrial respiratory capacity, measured through oxygen consumption rate (OCR) assays.

  • Metabolic Reprogramming: Steady-state metabolomics analysis of NDUFB4-deficient cells reveals:

    • Global decrease in citric acid cycle metabolites

    • Reduced availability of NADH-generating substrates

    • Shift toward glycolytic metabolism

  • Complex I Instability: While point mutations at specific residues may preserve complex I integrity, complete NDUFB4 deficiency often leads to decreased stability and reduced levels of assembled complex I.

These functional consequences highlight NDUFB4's critical role beyond simple structural support, positioning it as a key mediator of respirasome formation and metabolic regulation. The metabolic alterations observed in NDUFB4-deficient cells suggest potential therapeutic targets for mitochondrial disorders involving disrupted supercomplex assembly.

What experimental approaches effectively evaluate the functional consequences of NDUFB4 mutations?

Multi-disciplinary approaches are essential for comprehensively assessing the impact of NDUFB4 mutations:

  • Supercomplex Assembly Analysis:

    • Blue Native PAGE of digitonin-solubilized mitochondrial membranes followed by immunoblotting for complex I (NDUFA9), complex III, and complex IV components .

    • Quantification of supercomplex assembly efficiency through densitometry analysis.

  • Mitochondrial Respiration:

    • High-resolution respirometry using Oroboros or Seahorse systems to measure oxygen consumption rates.

    • Substrate-uncoupler-inhibitor titration protocols to assess specific complex activities.

    • Measurement of respiratory control ratios to evaluate coupling efficiency.

  • Metabolomic Analysis:

    • Targeted metabolomics focusing on TCA cycle intermediates and NADH/NAD+ ratios.

    • Isotope tracing experiments using 13C-labeled substrates to track metabolic flux alterations.

    • Integration of metabolomic data with respiratory measurements for comprehensive bioenergetic assessment .

  • Protein-Protein Interaction Studies:

    • Proximity labeling techniques (BioID, APEX) to identify altered interaction partners.

    • Crosslinking mass spectrometry to map changes in interaction interfaces.

    • Co-immunoprecipitation assays to quantify binding affinity changes.

  • Structural Analysis:

    • Cryo-EM of isolated mitochondrial membranes to visualize supercomplex architecture.

    • Molecular dynamics simulations to predict structural consequences of mutations.

Using complementary approaches provides robust validation of findings and comprehensive understanding of how specific mutations affect NDUFB4 function at multiple levels.

How can recombinant bovine NDUFB4 be utilized in structural studies of respiratory supercomplexes?

Recombinant bovine NDUFB4 offers several advantages for structural studies of respiratory supercomplexes:

  • Site-Specific Labeling Strategies:

    • Introduction of unique cysteines or unnatural amino acids at specific positions allows for site-directed labeling with fluorophores or crosslinkers.

    • These labeled variants can be reconstituted into purified supercomplexes for FRET-based distance measurements or crosslinking studies.

  • Cryo-EM Structure Determination:

    • Purified bovine heart mitochondria provide abundant respiratory complexes for structural studies.

    • Reconstitution of recombinant wild-type or mutant NDUFB4 into NDUFB4-depleted bovine mitochondrial membranes allows direct comparison of structural alterations.

    • Tagged recombinant NDUFB4 can facilitate orientation determination in cryo-EM maps.

  • Hybrid Methods Approach:

    • Integration of crosslinking mass spectrometry with molecular modeling.

    • Validation of interaction interfaces using site-directed mutagenesis of recombinant protein.

    • Correlation of structural data with functional measurements from respirometry.

  • Nanoscale Resolution of Supercomplex Architecture:

    • Recent structural studies have identified key protein-protein interactions between transmembrane complex I accessory subunits (including NDUFB4) and complex III .

    • These studies reveal that NDUFB4 is positioned at the interface with complex III, directly interacting with UQCRC1.

What are the challenges in developing research models to study NDUFB4 dysfunction in bovine systems?

Developing research models for bovine NDUFB4 dysfunction presents several unique challenges:

  • Genetic Manipulation Limitations:

    • Large animal models are considerably more challenging for genetic engineering compared to rodent systems.

    • CRISPR/Cas9 techniques in bovine cells require optimization for efficiency and specificity.

    • Primary bovine cells often have limited lifespan in culture, complicating stable genetic modification.

  • Tissue-Specific Expression Patterns:

    • NDUFB4 may have varying expression levels and potential splice variants across different bovine tissues.

    • Development of tissue-specific knockout or knockdown systems requires careful characterization of baseline expression patterns.

  • Phenotypic Assessment:

    • Subtle bioenergetic defects may manifest differently across tissues with varying metabolic demands.

    • Standardized methods for measuring mitochondrial function in bovine tissues are less established than human or mouse systems.

  • Translational Relevance:

    • Correlating bovine phenotypes with human mitochondrial disorders requires careful consideration of species differences.

    • Bovine-specific metabolic adaptations may influence the consequences of NDUFB4 dysfunction.

  • Technical Approaches to Address These Challenges:

    • Development of bovine induced pluripotent stem cells (iPSCs) for differentiation into relevant cell types.

    • Establishment of immortalized bovine cell lines with CRISPR/Cas9-engineered NDUFB4 mutations.

    • Utilization of ex vivo tissue slices for acute manipulation of NDUFB4 expression through viral vectors.

    • Validation of findings through comparative studies with human cellular models.

How does NDUFB4 function differ between tissue types and what implications does this have for research design?

NDUFB4 exhibits tissue-specific variations in expression, post-translational modifications, and functional importance:

  • Tissue Expression Patterns:

    • Highest expression in high-energy demanding tissues: heart, brain, liver, and skeletal muscle.

    • Lower expression in tissues with less oxidative metabolism: adipose tissue, certain immune cells.

    • These differences necessitate tissue-specific normalization when comparing NDUFB4 expression or function.

  • Supercomplex Organization Variations:

    • Heart tissue exhibits the highest proportion of assembled respirasomes (I₁III₂IV₁), making it particularly dependent on NDUFB4 function.

    • Brain tissue shows unique supercomplex compositions with higher proportions of complex I-IV associations.

    • These tissue-specific organizations suggest potentially different consequences of NDUFB4 dysfunction across organs.

  • Metabolic Context Influences:

    • Tissues with high fatty acid oxidation (heart, liver) may be more vulnerable to NDUFB4 dysfunction due to greater NADH production.

    • Glycolytic tissues may exhibit greater metabolic flexibility to compensate for NDUFB4 deficiency.

    • This metabolic context should inform the design of tissue-specific experimental readouts.

  • Research Design Implications:

    • Selection of appropriate cell models that reflect the metabolic characteristics of the tissue of interest.

    • Consideration of tissue-specific metabolic endpoints when assessing NDUFB4 dysfunction.

    • Development of tissue-specific rescue strategies that address the unique bioenergetic requirements.

    • Implementation of multi-tissue comparisons to understand differential vulnerability to NDUFB4 defects.

What are common technical challenges in detecting NDUFB4 in experimental samples and how can they be overcome?

Detection of NDUFB4 presents several technical challenges that require specific optimization strategies:

  • Low Abundance Challenges:

    • NDUFB4 is expressed at relatively low levels compared to core respiratory complex subunits.

    • Solution: Optimize sample loading for Western blots (typically 30-50 μg mitochondrial protein); use signal enhancement systems like HRP-conjugated polymers rather than standard secondary antibodies .

  • Membrane Protein Extraction Issues:

    • As a hydrophobic membrane protein, NDUFB4 requires careful solubilization.

    • Solution: Use digitonin (1-2%) for supercomplex preservation or stronger detergents like DDM (1%) for efficient extraction of individual NDUFB4 . Avoid ionic detergents like SDS for native protein studies.

  • Antibody Specificity Problems:

    • Cross-reactivity with other mitochondrial proteins can lead to misinterpretation.

    • Solution: Validate antibodies using NDUFB4 knockout controls; use recombinant monoclonal antibodies for highest specificity; optimize blocking conditions (5% BSA often superior to milk for membrane proteins) .

  • Detection in Tissue Samples:

    • Tissue autofluorescence and matrix effects can interfere with immunofluorescence studies.

    • Solution: Implement stringent autofluorescence quenching protocols; use spectral unmixing on confocal microscopes; consider tissue clearing techniques for thick sections.

  • Quantification Accuracy:

    • NDUFB4 levels may not directly correlate with supercomplex assembly.

    • Solution: Always complement protein level quantification with functional and structural assays; normalize to appropriate housekeeping proteins for the specific subcellular fraction.

How can researchers distinguish between assembly defects and functional defects when studying NDUFB4 mutations?

Distinguishing assembly from functional defects requires a systematic experimental approach:

  • Sequential Analysis Framework:

    • First assess protein expression and stability of mutant NDUFB4 (Western blot)

    • Next evaluate incorporation into complex I (BN-PAGE with complex I antibodies)

    • Then analyze supercomplex formation (BN-PAGE with antibodies to multiple complexes)

    • Finally measure functional consequences (respirometry, membrane potential, ROS production)

  • Specific Experimental Approaches:

    • In-gel activity assays: BN-PAGE followed by incubation with NADH and electron acceptors to visualize enzymatic activity directly in the gel

    • Submitochondrial particle (SMP) studies: Inside-out mitochondrial vesicles allow direct access to complex I NADH binding site

    • Functional complementation: Rescue experiments with wild-type protein can distinguish dominant-negative effects from loss-of-function

  • Comparative Analysis Strategies:

    • Correlation analysis between assembly level (quantified from BN-PAGE) and function (from respirometry)

    • Temperature-dependent studies: Some mutations may show normal assembly but temperature-sensitive functional defects

    • Kinetic analyses: Measurement of substrate-dependent activity can reveal functional defects with intact assembly

Research using NDUFB4 point mutations at Asn24 and Arg30 demonstrated this approach by showing that these specific mutations disrupted supercomplex assembly while minimally affecting complex I assembly, allowing researchers to distinguish between these two processes .

What are best practices for designing and interpreting NDUFB4 mutation studies in the context of respiratory chain function?

Several best practices ensure robust and interpretable results in NDUFB4 mutation studies:

  • Mutation Selection Strategy:

    • Prioritize evolutionarily conserved residues between bovine and human NDUFB4

    • Consider both transmembrane and soluble domains for comprehensive functional mapping

    • Include conservative and non-conservative substitutions to distinguish structural from chemical requirements

    • Target residues implicated in protein-protein interactions based on structural data (e.g., Asn24, Arg30)

  • Experimental Design Considerations:

    • Include appropriate controls: wild-type rescue, unrelated mutations, empty vector

    • Use inducible expression systems to control protein levels and avoid adaptation

    • Implement multiple independent clones for each mutation to control for clonal effects

    • Perform experiments under different metabolic conditions (glucose vs. galactose media) to reveal subtle phenotypes

  • Comprehensive Phenotypic Assessment:

    • Beyond respiratory chain function, assess mitochondrial morphology, membrane potential, and ROS production

    • Perform metabolomic analysis to identify metabolic adaptations and potential biomarkers

    • Consider growth curve analysis under different nutrient conditions as an integrated readout of cellular fitness

  • Interpretation Framework:

    • Distinguish primary from secondary effects through time-course studies

    • Consider protein half-life and turnover when interpreting acute vs. chronic effects

    • Correlate biochemical data with structural predictions to develop mechanistic models

    • Validate key findings using orthogonal approaches (e.g., confirm spectrophotometric assays with oxygen consumption measurements)

By adhering to these best practices, researchers can generate reliable and meaningful data on NDUFB4 function while avoiding common pitfalls in the interpretation of mitochondrial mutation studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.