Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFC2; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MMTGRQGRATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGLHR QLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYGEVFEEFHPVR
Uniprot No.

Target Background

Function

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be non-catalytic, with Complex I functioning in the transfer of electrons from NADH to the respiratory chain. Ubiquinone is considered the enzyme's immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFC2 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the biological function of NDUFC2 in mitochondrial complex I?

NDUFC2 is a membrane protein assigned to the ND2 module within the proton pumping modules of complex I. Located in the intermembrane space, NDUFC2 interacts with at least 12 other subunits, including components of the ND1 module (such as NDUFA8), ND2 module subunits (NDUFA10, NDUFA11, NDUFS5, NDUFC1, and ND2), and ND4 module constituents (NDUFB1, NDUFB5, NDUFB10, NDUFB11, and ND4) . These multiple interactions suggest NDUFC2 plays a crucial role in the structural organization and stability of complex I.

Functionally, NDUFC2 serves as an essential component for the proper assembly of the membrane arm of complex I. Research has demonstrated that the absence of NDUFC2 prevents the formation of fully assembled complex I, resulting in significant reductions in complex I activity and impairment of mitochondrial respiration . Without functional NDUFC2, complex I assembly stalls at the Q module formation stage, preventing the incorporation of the ND1 subunit into the inner mitochondrial membrane .

How can recombinant bovine NDUFC2 be produced for experimental studies?

The production of recombinant bovine NDUFC2 typically involves molecular cloning techniques similar to those used for other nuclear-encoded mitochondrial proteins. Based on established protocols for similar proteins, the methodology would involve:

  • Gene amplification and cloning: PCR amplification of the bovine NDUFC2 coding sequence from bovine cDNA libraries or commercial gene synthesis. The amplified product can be cloned into an appropriate expression vector, such as pcDNA4/TO/myc-His for mammalian expression or pET vectors for bacterial expression .

  • Vector construction: The construct design should include appropriate tags (such as His-tag or Myc-tag) for purification and detection, and can incorporate an inducible promoter system for controlled expression .

  • Expression system selection: While bacterial expression systems can be used, mammalian expression systems are often preferred for mitochondrial proteins to ensure proper folding and post-translational modifications. For functional studies, expression in cell lines lacking endogenous NDUFC2 or with knocked-down NDUFC2 would be advantageous .

  • Purification strategy: Affinity chromatography using the incorporated tag (e.g., His-tag) followed by size exclusion chromatography to obtain pure protein.

For researchers investigating bovine NDUFC2 function in relation to its human ortholog, it's important to note that experimental approaches validated in human cell models can often be adapted for bovine protein studies, with appropriate consideration for species-specific differences .

What methods are used to verify correct localization of recombinant NDUFC2 to mitochondria?

Verification of correct mitochondrial localization of recombinant NDUFC2 can be achieved through multiple complementary approaches:

  • Subcellular fractionation and Western blotting: This technique involves isolating mitochondrial, cytosolic, and nuclear fractions from cells expressing recombinant NDUFC2, followed by Western blot analysis using antibodies against NDUFC2 (or its tag) and markers for different cellular compartments. Enrichment of NDUFC2 in the mitochondrial fraction would confirm proper localization .

  • Immunofluorescence microscopy: Cells expressing tagged recombinant NDUFC2 can be fixed and stained with antibodies against the tag and mitochondrial markers (such as TOMM20 or MitoTracker dyes). Colocalization of the signals indicates mitochondrial localization .

  • Protease protection assays: Mitochondria isolated from cells expressing recombinant NDUFC2 can be treated with proteases in the presence or absence of detergents. If NDUFC2 is properly localized to the intermembrane space, it should be protected from proteolysis unless the mitochondrial membranes are disrupted .

  • Blue Native PAGE and complexome profiling: These techniques can verify the incorporation of recombinant NDUFC2 into complex I and its subcomplexes. The presence of NDUFC2 in the expected complex I assembly intermediates would confirm not only localization but also functional integration .

Using these methodologies, researchers can confidently establish that recombinant bovine NDUFC2 correctly targets to mitochondria and participates in complex I assembly.

What is the predicted structure of bovine NDUFC2 and how does it compare to the human ortholog?

The bovine NDUFC2 protein, like its human ortholog, is a hydrophobic membrane protein that localizes to the intermembrane space of the mitochondria. Based on structural studies of complex I from various species:

Bovine NDUFC2 is predicted to contain transmembrane domains that anchor it to the inner mitochondrial membrane, with portions extending into the intermembrane space. The protein likely adopts a conformation that facilitates interactions with multiple other subunits of complex I, particularly those of the ND1, ND2, and ND4 modules .

Comparative analysis would reveal that bovine and human NDUFC2 share high sequence homology, reflecting their conserved function in complex I assembly. The contact points with other subunits (at least 12 different subunits in humans) would likely be preserved in the bovine ortholog, including interactions with NDUFA8, NDUFA10, NDUFA11, NDUFS5, NDUFC1, ND2, NDUFB1, NDUFB5, NDUFB10, NDUFB11, and ND4 .

Structural predictions would suggest that certain regions of NDUFC2 are particularly important for its function, especially those involved in protein-protein interactions with other complex I subunits. For instance, regions interacting with the ND1 module would be critical, as NDUFC2 appears to function as a scaffold for ND1 module incorporation during complex I assembly .

How can complexome profiling be used to understand the role of recombinant bovine NDUFC2 in complex I assembly?

Complexome profiling is a powerful technique combining blue native polyacrylamide gel electrophoresis (BN-PAGE) with mass spectrometry to analyze protein complex composition and assembly. For investigating recombinant bovine NDUFC2's role in complex I assembly, the following methodological approach would be effective:

  • Sample preparation: Generate cellular models (preferably bovine cells or human cells expressing bovine NDUFC2) with either:

    • Knockout/knockdown of endogenous NDUFC2

    • Expression of wild-type recombinant bovine NDUFC2

    • Expression of mutant recombinant bovine NDUFC2

  • BN-PAGE separation: Isolate mitochondria from these cells, solubilize mitochondrial membranes with mild detergents (typically digitonin or n-dodecyl-β-D-maltoside), and separate the protein complexes by BN-PAGE.

  • Gel processing: Cut the gel lane into equal slices and subject each slice to in-gel tryptic digestion.

  • Mass spectrometry analysis: Analyze each slice by liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify the proteins present and their relative abundance.

  • Data analysis: Calculate migration profiles for each identified protein and cluster proteins with similar profiles to identify assembly intermediates and subcomplexes.

This approach allows researchers to identify at which stage(s) complex I assembly stalls in the absence of NDUFC2, and which assembly intermediates accumulate. Based on previous studies with human NDUFC2, one would expect to observe:

  • Accumulation of the Q module (~300 kDa) assembly intermediate comprising the Q module along with assembly factors like TIMMDC1 and NDUFA13

  • Accumulation of a larger intermediate (~715-800 kDa) containing the Q-intermediate with NDUFA13, TIMMDC1, ACAD9, ECSIT, NDUFAF1, and TMEM126B

  • Potential accumulation of the ND4 module with assembly factors TMEM70 and FOXRED1

  • Absence or reduction of intact complex I and complex I-containing supercomplexes

Comparing the complexome profiles between wild-type and mutant NDUFC2 variants would provide detailed insights into how specific domains or residues of bovine NDUFC2 contribute to complex I assembly.

What are the functional consequences of introducing mutations in key domains of recombinant bovine NDUFC2?

To investigate the functional consequences of mutations in key domains of recombinant bovine NDUFC2, researchers can employ a systematic mutagenesis approach followed by functional assays:

  • Targeted mutagenesis strategy:

    • Generate a panel of NDUFC2 mutants targeting conserved residues, particularly those at:

      • Interfaces with other complex I subunits

      • Transmembrane domains

      • Regions homologous to known pathogenic variants in human NDUFC2 (such as p.His58Leu)

    • Include controls such as wild-type NDUFC2 and known loss-of-function variants

  • Expression system:

    • Express the mutant constructs in NDUFC2-deficient cells (either NDUFC2-knockout cells or patient-derived fibroblasts with NDUFC2 mutations)

    • Lentiviral transduction systems can be particularly effective for these experiments

  • Functional assays to assess the impact of mutations:

    a. Complex I assembly analysis:

    • Blue Native PAGE followed by immunoblotting to assess complex I assembly and the formation of supercomplexes

    • Complexome profiling to identify specific assembly intermediates that accumulate with each mutation

    b. Complex I activity assays:

    • Spectrophotometric measurement of NADH:ubiquinone oxidoreductase activity

    • Oxygen consumption rate measurements using platforms like Seahorse XF Analyzer

    • In-gel activity assays following BN-PAGE

    c. Protein stability and interaction studies:

    • Co-immunoprecipitation to assess interactions with other complex I subunits

    • Protein turnover rates using pulse-chase experiments

    • Thermal shift assays to assess protein stability

  • Phenotypic consequences:

    • Assessment of mitochondrial membrane potential

    • Measurement of reactive oxygen species production

    • Analysis of mitochondrial morphology

    • Cell viability and growth rate measurements

Based on studies of human NDUFC2, mutations affecting the interaction with the ND1 and ND2 modules would likely cause the most severe functional defects, as these interactions appear critical for complex I assembly . Mutations in residues involved in ND4 module interactions might have more moderate effects, potentially allowing partial complex I assembly but compromising stability or activity.

How can lentiviral rescue experiments be designed to validate the pathogenicity of recombinant bovine NDUFC2 variants?

Lentiviral rescue experiments are powerful tools for validating the pathogenicity of protein variants and have been successfully used with human NDUFC2 . For bovine NDUFC2 variants, a comprehensive experimental design would include:

  • Vector construction:

    • Generate lentiviral vectors containing:

      • Wild-type bovine NDUFC2 cDNA (positive control)

      • Mutant bovine NDUFC2 variants

      • Empty vector (negative control)

    • Include an inducible promoter system (e.g., tetracycline-inducible) for controlled expression

    • Incorporate appropriate tags for detection and quantification

  • Cell model preparation:

    • Use cells with NDUFC2 deficiency, such as:

      • CRISPR-Cas9 generated NDUFC2-knockout bovine cell lines

      • Cell lines from patients with NDUFC2 mutations (for cross-species complementation studies)

    • Characterize baseline complex I assembly and activity in these cells

  • Transduction protocol:

    • Transduce cells with lentiviral particles at controlled multiplicity of infection

    • Select for successfully transduced cells

    • Induce expression using doxycycline for 72 hours (sufficient time for complete complex I assembly)

  • Comprehensive assessment of rescue:

    a. Protein expression analysis:

    • Western blot to confirm expression of recombinant bovine NDUFC2

    • Quantify expression levels relative to endogenous levels in control cells

    b. Complex I assembly evaluation:

    • Blue Native PAGE with immunoblotting to assess:

      • Levels of fully assembled complex I

      • Presence of assembly intermediates

      • Formation of supercomplexes

    • Complexome profiling for detailed assembly intermediate analysis

    c. Functional studies:

    • Complex I enzyme activity assays

    • Oxygen consumption rate measurements

    • Assessment of ATP production

    • Mitochondrial membrane potential analysis

  • Data analysis and interpretation:

    • Compare the degree of rescue between wild-type and mutant variants

    • Quantify the restoration of complex I assembly and function as percentages of control levels

    • Correlate the severity of assembly defects with specific domains/residues affected by mutations

Based on previous studies with human NDUFC2 variants, complete rescue may not always be achieved even with wild-type NDUFC2, possibly due to the presence of mutant protein or aberrant subassembly species affecting the rescue process . Nevertheless, significant improvements in complex I assembly and function would provide strong evidence for the pathogenicity of the tested variants.

What approaches can be used to study the interaction of recombinant bovine NDUFC2 with other complex I subunits?

Studying protein-protein interactions between recombinant bovine NDUFC2 and other complex I subunits requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP) studies:

    • Express tagged recombinant bovine NDUFC2 in appropriate cell models

    • Isolate mitochondria and solubilize using mild detergents

    • Perform immunoprecipitation using antibodies against the tag

    • Analyze co-precipitating proteins by Western blot or mass spectrometry

    • Include appropriate controls (e.g., immunoprecipitation with non-specific antibodies)

  • Proximity labeling techniques:

    • Generate fusion proteins of NDUFC2 with enzymes like BioID or APEX2

    • Express these constructs in cells and activate the enzyme to biotinylate nearby proteins

    • Isolate biotinylated proteins using streptavidin-based pulldown

    • Identify interacting partners by mass spectrometry

    • This approach can identify both stable and transient interactions in the native cellular environment

  • Crosslinking mass spectrometry (XL-MS):

    • Treat mitochondria containing recombinant bovine NDUFC2 with chemical crosslinkers

    • Digest crosslinked proteins and analyze by mass spectrometry

    • Identify crosslinked peptides to map interaction sites at amino acid resolution

    • This technique can provide detailed structural information about the interaction interfaces

  • In vitro binding assays:

    • Express and purify recombinant bovine NDUFC2 and potential interacting partners

    • Perform direct binding assays using techniques like surface plasmon resonance or microscale thermophoresis

    • Determine binding kinetics and affinities

    • Test the effects of mutations on binding properties

  • Structural studies:

    • Use cryo-electron microscopy of purified complex I containing recombinant bovine NDUFC2

    • Perform molecular modeling and docking studies

    • Validate models with site-directed mutagenesis of predicted interaction sites

Based on studies with human NDUFC2, key interactions to investigate would include those with NDUFA8 (ND1 module), components of the ND2 module (NDUFA10, NDUFA11, NDUFS5, NDUFC1, and ND2), and ND4 module constituents (NDUFB1, NDUFB5, NDUFB10, NDUFB11, and ND4) . Special attention should be paid to interactions that appear critical for complex I assembly, particularly those involved in the incorporation of the ND1 and ND2 modules into the membrane.

How does the expression of recombinant bovine NDUFC2 affect mitochondrial function in cellular models of NDUFC2 deficiency?

To comprehensively assess the impact of recombinant bovine NDUFC2 expression on mitochondrial function in cellular models of NDUFC2 deficiency, researchers should employ a battery of functional assays:

  • Cellular models:

    • CRISPR-Cas9 knockout cells lacking endogenous NDUFC2

    • Patient-derived fibroblasts with confirmed NDUFC2 pathogenic variants

    • Cell lines with inducible knockdown of endogenous NDUFC2

  • Expression systems:

    • Lentiviral vectors for stable expression of recombinant bovine NDUFC2

    • Inducible expression systems to control timing and level of expression

    • Include appropriate controls (wild-type human NDUFC2, empty vector)

  • Functional assessments:

    a. Respiratory chain function:

    • High-resolution respirometry to measure oxygen consumption rates in intact cells and permeabilized cells with various substrates

    • ATP production rate measurements

    • NAD+/NADH ratio determination

    • Complex I-specific activity assays

    b. Mitochondrial membrane potential:

    • Flow cytometry with potential-sensitive dyes like TMRM or JC-1

    • Live-cell imaging with ratiometric indicators

    c. Reactive oxygen species (ROS) production:

    • Measurement of superoxide using probes like MitoSOX

    • Assessment of hydrogen peroxide using Amplex Red assays

    • Evaluation of oxidative damage markers (protein carbonylation, lipid peroxidation)

    d. Mitochondrial dynamics and quality control:

    • Analysis of mitochondrial morphology using fluorescence microscopy

    • Assessment of mitophagy rates

    • Measurement of mitochondrial biogenesis markers

    e. Cellular consequences:

    • Cell proliferation and viability assays

    • Metabolic profiling using techniques like Seahorse XF analysis

    • Assessment of apoptotic markers

  • Time-course experiments:

    • Analyze changes in mitochondrial function at different time points after induction of recombinant bovine NDUFC2 expression

    • Correlate functional recovery with complex I assembly kinetics

  • Comparative analysis:

    • Compare the efficacy of bovine NDUFC2 versus human NDUFC2 in rescuing the phenotype

    • Assess whether certain functions are restored more effectively than others

What are the common challenges in expressing and purifying recombinant bovine NDUFC2?

Expression and purification of recombinant bovine NDUFC2 present several technical challenges that researchers should anticipate and address:

  • Expression challenges:

    • Protein toxicity: Overexpression of membrane proteins like NDUFC2 may be toxic to host cells, necessitating the use of inducible expression systems with careful titration of induction conditions .

    • Protein misfolding: As a mitochondrial membrane protein, NDUFC2 requires specific chaperones and an appropriate membrane environment for proper folding. Expression in systems lacking these factors (e.g., bacterial systems) may lead to misfolding and aggregation.

    • Import efficiency: Even with correct targeting sequences, the import of recombinant NDUFC2 into mitochondria may be inefficient, especially at high expression levels that can saturate the import machinery .

  • Purification challenges:

    • Detergent selection: As a membrane protein, NDUFC2 requires detergents for solubilization. The choice of detergent is critical—too harsh detergents may denature the protein, while too mild detergents may not effectively solubilize it.

    • Protein stability: Once extracted from the membrane environment, NDUFC2 may exhibit limited stability, necessitating rapid purification and potentially the inclusion of lipids or amphipols to maintain native-like conditions.

    • Aggregation tendency: Hydrophobic membrane proteins like NDUFC2 have a propensity to aggregate, especially during concentration steps.

  • Functional validation challenges:

    • Assessing proper folding: Without enzymatic activity, confirming the correct folding of isolated NDUFC2 can be challenging.

    • Verifying functional state: The functionality of purified NDUFC2 is best assessed through its ability to incorporate into complex I or rescue NDUFC2-deficient cells, which requires additional experimental setups .

  • Troubleshooting strategies:

    • Optimize expression conditions: Test different expression systems, induction protocols, and growth temperatures to maximize soluble protein yield.

    • Engineer fusion constructs: Consider fusion partners that can enhance solubility and stability, such as MBP or SUMO.

    • Screen detergent conditions: Systematically test different detergents, detergent concentrations, and detergent:protein ratios for optimal solubilization.

    • Employ co-expression strategies: Co-express NDUFC2 with its interacting partners, particularly NDUFC1, to promote proper folding and stability.

    • Consider membrane mimetics: For structural and functional studies, reconstitute purified NDUFC2 into nanodiscs or liposomes to provide a more native-like membrane environment.

How can we optimize transfection efficiency for recombinant bovine NDUFC2 in mammalian cells?

Optimizing transfection efficiency for recombinant bovine NDUFC2 in mammalian cells requires systematic testing of multiple parameters and careful consideration of the unique challenges posed by mitochondrial membrane proteins:

  • Vector design optimization:

    • Promoter selection: Test different promoters (CMV, EF1α, PGK) to identify which provides optimal expression levels without toxicity.

    • Codon optimization: Adapt the bovine NDUFC2 coding sequence for optimal expression in the target mammalian cell line.

    • Inclusion of introns: Adding introns to the expression construct can enhance nuclear export of mRNA and improve expression.

    • UTR engineering: Optimize 5' and 3' untranslated regions to enhance mRNA stability and translation efficiency.

    • Tag placement: Test both N-terminal and C-terminal tags to determine which interferes least with protein folding and function .

  • Transfection method optimization:

    a. Lipid-based transfection:

    • Test various commercial reagents (Lipofectamine, FuGENE, TransIT, etc.)

    • Optimize DNA:lipid ratios for each cell type

    • Determine optimal cell confluency at transfection (typically 70-80%)

    • Evaluate transfection in serum-free versus serum-containing media

    b. Electroporation:

    • Optimize voltage, capacitance, and pulse duration

    • Determine optimal cell density and DNA concentration

    • Test different electroporation buffers

    c. Viral transduction:

    • Consider lentiviral or adenoviral delivery for hard-to-transfect cells

    • Optimize viral titer and multiplicity of infection

    • Include polybrene to enhance transduction efficiency for lentivirus

  • Cell line selection:

    • Test transfection efficiency across multiple cell lines (HEK293T, COS-7, CHO, etc.)

    • Consider using cell lines with well-characterized mitochondrial import machinery

    • For functional studies, NDUFC2-deficient cell lines offer the advantage of minimal background

  • Culture condition optimization:

    • Evaluate different cell densities at transfection

    • Test transfection in growth phase versus contact-inhibited cells

    • Optimize recovery time and conditions post-transfection

  • Transfection validation methods:

    • Expression level assessment: Western blotting with antibodies against NDUFC2 or its tag

    • Subcellular localization: Immunofluorescence microscopy to verify mitochondrial targeting

    • Functional validation: Blue Native PAGE to assess incorporation into complex I

A systematic optimization approach would involve creating a matrix of conditions, testing each parameter independently, and then combining the best conditions. Given the challenges of expressing mitochondrial membrane proteins, efficiency rates of 40-60% might be considered successful for transient transfection, while stable expression through lentiviral transduction or selection of stable transfectants might ultimately provide more consistent results for long-term studies .

How does bovine NDUFC2 compare to its orthologs in other species in terms of structure and function?

Comparative analysis of NDUFC2 across species provides valuable insights into its evolutionary conservation and functional importance:

What can we learn from comparing the effects of mutations in bovine NDUFC2 to known pathogenic variants in human NDUFC2?

Comparative analysis of mutations in bovine NDUFC2 with pathogenic variants in human NDUFC2 provides valuable insights for both basic research and potential therapeutic applications:

  • Mapping conserved functional domains:
    By introducing mutations in bovine NDUFC2 that correspond to known human pathogenic variants (such as p.His58Leu and p.His116_Arg119delins21) , researchers can identify highly conserved functional domains. If these mutations produce similar biochemical phenotypes across species, it suggests evolutionary conservation of structure-function relationships.

  • Structure-function relationships:
    Comparative mutagenesis studies can reveal which protein domains are most critical for:

    • Proper mitochondrial targeting

    • Interaction with other complex I subunits

    • Stability and turnover of the protein

    • Assembly of specific complex I modules (ND1, ND2, ND4)

  • Biochemical consequences:
    Analysis of the biochemical effects of equivalent mutations can show whether:

    • The same complex I assembly intermediates accumulate (e.g., Q module with TIMMDC1 and NDUFA13)

    • Similar defects in ND1 and ND2 module assembly occur

    • Comparable impacts on respiratory chain function are observed

  • Species-specific differences:
    Some mutations might have different effects in bovine versus human NDUFC2 due to:

    • Subtle structural differences between species

    • Different interaction strengths with partner proteins

    • Species-specific compensatory mechanisms

    • Differences in protein stability or turnover rates

  • Therapeutic implications:
    Identifying mutations with milder phenotypes in bovine NDUFC2 compared to their human counterparts could suggest potential compensatory mechanisms that might be exploited therapeutically. Conversely, mutations with more severe effects in bovine models might highlight particularly vulnerable domains to avoid targeting in therapeutic approaches.

  • Cross-species rescue potential:
    Evaluating whether wild-type bovine NDUFC2 can rescue human cells harboring NDUFC2 pathogenic variants (and to what degree) could provide insights into the feasibility of cross-species protein replacement therapies. Previous studies have shown that wild-type human NDUFC2 can ameliorate defects in fibroblasts from patients with pathogenic NDUFC2 variants, suggesting similar cross-species approaches might be viable .

  • Model validation:
    Comparing the phenotypes of equivalent mutations helps validate bovine models for studying human NDUFC2-related diseases. If the same mutations cause similar biochemical and cellular defects, it strengthens the relevance of findings in bovine systems for understanding human pathology.

What novel approaches can be developed to study the dynamic interactions of NDUFC2 during complex I assembly?

Investigating the dynamic interactions of NDUFC2 during complex I assembly requires innovative approaches that can capture transient interactions and assembly intermediates:

  • Time-resolved complexome profiling:

    • Develop techniques to synchronize complex I assembly (e.g., using inducible expression systems)

    • Perform complexome profiling at multiple time points after induction

    • Track the appearance and disappearance of NDUFC2-containing assembly intermediates

    • This approach could reveal the sequence and kinetics of NDUFC2 incorporation into complex I

  • Integrative structural biology approaches:

    • Combine cryo-electron microscopy with crosslinking mass spectrometry

    • Use hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Apply integrative modeling to predict assembly pathways

    • These methods could generate structural models of NDUFC2-containing assembly intermediates

  • Advanced live-cell imaging techniques:

    • Develop split fluorescent protein systems where complementation occurs upon NDUFC2 interaction with other complex I subunits

    • Use FRET-based sensors to monitor NDUFC2 interactions in real-time

    • Apply single-molecule tracking to follow individual NDUFC2 molecules during mitochondrial import and complex I incorporation

    • These approaches would provide spatial and temporal information about NDUFC2 dynamics

  • Synthetic biology approaches:

    • Design minimal complex I systems with defined components

    • Create chemically-inducible dimerization systems to control NDUFC2 interactions

    • Develop optogenetic tools to spatiotemporally regulate NDUFC2 function

    • These methods could help dissect the specific roles of NDUFC2 in complex I assembly

  • High-throughput interaction mapping:

    • Apply BioID or APEX2 proximity labeling at different stages of complex I assembly

    • Develop multiplexed immunoprecipitation assays to simultaneously monitor multiple interactions

    • Use protein complementation assays in array format to screen for interaction partners

    • These techniques could comprehensively map the changing interaction network of NDUFC2 during assembly

  • Computational approaches:

    • Develop machine learning algorithms to predict assembly pathways from experimental data

    • Use molecular dynamics simulations to model NDUFC2 interactions with other subunits

    • Apply network analysis to interpret complexome profiling data

    • These computational methods could generate testable hypotheses about NDUFC2 function

The combination of these approaches would provide unprecedented insights into how NDUFC2 participates in complex I assembly, potentially revealing new therapeutic targets for mitochondrial diseases caused by defects in this process. Particular attention should be paid to the transition points between different assembly intermediates, especially the incorporation of the ND1 and ND2 modules, where NDUFC2 appears to play a critical role .

How might recombinant bovine NDUFC2 be utilized in therapeutic approaches for mitochondrial disorders?

The potential therapeutic applications of recombinant bovine NDUFC2 for mitochondrial disorders represent an exciting frontier in translational research:

  • Protein replacement therapy approaches:

    • Development of recombinant bovine NDUFC2 protein with cell-penetrating peptides or mitochondrial-targeting sequences

    • Design of nanoparticle-based delivery systems to transport recombinant NDUFC2 to mitochondria

    • Engineering of extracellular vesicles (EVs) loaded with NDUFC2 protein or mRNA

    • These approaches could potentially deliver functional NDUFC2 to replace defective protein in patient cells

  • Gene therapy strategies:

    • Optimization of bovine NDUFC2 coding sequences for human expression

    • Development of mitochondrially-targeted adeno-associated virus (AAV) vectors carrying bovine NDUFC2

    • Creation of lentiviral vectors with tissue-specific promoters for targeted expression

    • These gene delivery methods could provide long-term expression of functional NDUFC2

  • Cell-based therapies:

    • Generation of induced pluripotent stem cells (iPSCs) engineered to express bovine NDUFC2

    • Differentiation of these iPSCs into relevant cell types (neurons, cardiomyocytes)

    • Transplantation of engineered cells into affected tissues

    • This approach could provide a renewable source of cells with functional complex I

  • Comparative efficacy considerations:

    • Evaluation of bovine versus human NDUFC2 for therapeutic efficacy

    • Assessment of potential immunogenicity of bovine NDUFC2 in humans

    • Study of the longevity and stability of bovine NDUFC2 in human cellular environments

    • These comparisons would help determine whether bovine NDUFC2 offers advantages over human NDUFC2 for therapeutic applications

  • Combination therapies:

    • Integration of NDUFC2 replacement with mitochondrial-targeted antioxidants

    • Co-delivery of NDUFC2 with other complex I subunits

    • Combination with compounds that enhance mitochondrial biogenesis

    • These multi-targeted approaches might provide synergistic benefits

  • Precision medicine applications:

    • Development of variant-specific therapeutic strategies

    • Creation of patient-derived organoids to test efficacy of bovine NDUFC2 replacement

    • Personalized dosing and delivery approaches based on mutation type and tissue involvement

    • These tailored approaches would maximize therapeutic benefit while minimizing potential side effects

Previous research has demonstrated that lentiviral expression of wild-type NDUFC2 can ameliorate complex I deficiency in patient-derived fibroblasts harboring pathogenic NDUFC2 variants . While these proof-of-concept studies used human NDUFC2, the high conservation between bovine and human proteins suggests bovine NDUFC2 might serve as an alternative therapeutic protein, potentially with advantages in stability or function in certain contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.