Recombinant Bovine NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine MT-ND3

Recombinant Bovine MT-ND3 is a synthetic version of the mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 3. It is produced in Escherichia coli expression systems with an N-terminal His tag for purification . Key features include:

  • Molecular Weight: ~13 kDa (115 amino acids)

  • Gene Origin: Mitochondrial MT-ND3 gene (UniProt ID: P03898)

  • Function: Integral component of Complex I, facilitating electron transfer from NADH to ubiquinone

Enzymatic Activity

  • Catalytic Role: Facilitates electron transfer via iron-sulfur clusters, with a redox potential of -250 mV .

  • Inhibitor Binding: Piericidin A competes with ubiquinone at the ND3-associated active site, reducing activity by >90% .

Disease Associations

ConditionMechanistic Link to MT-ND3 DefectsKey Study Findings
Leigh SyndromeImpaired proton pumping → ATP deficiency80% of patients show ND3 mutations
Parkinson’s DiseaseROS overproduction due to stalled electronsND3 polymorphisms increase risk 2.5×

Recombinant Production Workflow

  1. Cloning: Bovine MT-ND3 gene inserted into pET vectors .

  2. Expression: Induced with IPTG in E. coli BL21(DE3) .

  3. Purification: Ni-NTA affinity chromatography yields >95% purity .

Key Research Findings

  1. Assembly Dependency:

    • Knockout of ND3 in Chlamydomonas abolished Complex I activity (0% NADH:duroquinone oxidoreductase activity vs. wild type) .

    • BN-PAGE confirmed absence of the 950 kDa holoenzyme in ND3-deficient strains .

  2. Structural Modeling:

    • Bovine MT-ND3 forms a helical hairpin within the membrane, with conserved Glu37 critical for proton coupling .

    • 3.0-Å cryo-EM maps reveal piericidin A binding at the ND3-ND1 interface, blocking ubiquinone reduction .

  3. Evolutionary Adaptations:

    • Nuclear-encoded ND3 in algae shows reduced hydrophobicity (GRAVY index -0.2 vs. -0.8 in mammals), aiding mitochondrial import .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
The ND3 subunit is a core component of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. The presence of ND3 is essential for the catalytic activity of complex I.
Gene References Into Functions
  1. Data indicate that in the D-form of complex I, the ND3 subunit crosslinks to the 39 kDa (NDUFA9) subunit. PMID: 23454639
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Q1.1: What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I. This protein plays an essential role in the catalytic activity of Complex I by facilitating electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. The protein is encoded in the mitochondrial DNA rather than nuclear DNA, making it unique compared to many other cellular proteins. MT-ND3's function is critical for cellular energy production through oxidative phosphorylation pathways, including respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.

Q1.2: How is MT-ND3 structurally integrated into Complex I, and what domains are critical for its function?

MT-ND3 is structurally positioned within the membrane domain of Complex I, where it contributes to the proton-pumping mechanism. The protein contains a conserved loop region that is particularly important for the active/deactive state transition of Complex I. This loop, which includes the glycine residue at position 40 (G40), plays a regulatory role in the conformational changes that mediate between active and deactive states of Complex I. These structural characteristics make MT-ND3 essential for both the assembly and catalytic function of the entire complex. Mutations in this conserved loop, such as the G40K substitution, can significantly impact the functional dynamics of Complex I by altering the stability of state transitions.

Q1.3: What techniques are used to identify novel subunits of Complex I like MT-ND3?

Identification of novel subunits of Complex I involves a multi-technique approach:

  • Electrospray mass spectrometry: Used to analyze intact complex I and its subcomplexes, allowing detection of proteins with masses not corresponding to known subunits.

  • Two-dimensional polyacrylamide gel electrophoresis (2D-PAGE): Enables fractionation of complex proteins based on both isoelectric point and molecular weight, facilitating isolation of individual subunits.

  • Trypsin digestion and peptide sequencing: After 2D-PAGE isolation, proteins are digested with trypsin, and the resulting peptides are sequenced to confirm uniqueness compared to known subunits.

  • cDNA sequencing: Following peptide sequence determination, cDNA libraries are screened to identify the full sequence of the protein and establish its relationship to other known proteins.

This methodological pipeline proved successful in identifying additional subunits beyond the 41 previously known components of bovine heart mitochondrial Complex I.

Q2.1: What are the optimal methods for recombinant expression of bovine MT-ND3 protein?

Recombinant expression of bovine MT-ND3 presents unique challenges due to its hydrophobic nature and mitochondrial origin. A methodological approach includes:

  • Codon optimization: Adapting the mitochondrial genetic code for cytoplasmic expression systems by optimizing codons for the host organism.

  • Expression vector selection: Using specialized vectors containing strong inducible promoters (like T7) and appropriate fusion tags (such as 6xHis or GST) to enhance solubility and facilitate purification.

  • Host selection: Bacterial systems like E. coli BL21(DE3) or C41(DE3) strains are preferred for membrane proteins, while insect cells or mammalian expression systems may provide better post-translational modifications.

  • Membrane protein solubilization: Incorporation of detergents (DDM, LDAO) or amphipols during extraction and purification to maintain native-like conformations.

  • Purification strategy: Implementing a multi-step purification process including affinity chromatography followed by size exclusion chromatography to obtain pure protein.

These approaches must be optimized for each specific experimental goal, whether structural studies, functional assays, or antibody production.

Q2.2: How can researchers effectively measure MT-ND3 activity within the Complex I system?

  • Spectrophotometric NADH oxidation assays: Monitoring the decrease in NADH absorbance at 340 nm in the presence of appropriate electron acceptors (ubiquinone-1 or coenzyme Q).

  • Oxygen consumption measurements: Using oxygen electrodes or respirometry to measure Complex I-driven oxygen consumption in isolated mitochondria or reconstituted systems.

  • Site-directed mutagenesis: Creating specific mutations in MT-ND3 (such as G40K) to assess changes in activity compared to wild-type complex, allowing for structure-function correlation.

  • Electron paramagnetic resonance (EPR): Detecting changes in iron-sulfur cluster redox states to measure electron transfer capabilities.

  • Blue native PAGE coupled with in-gel activity stains: Visualizing active Complex I in native conditions while preserving MT-ND3 contributions.

These techniques should be complemented with appropriate controls, including inhibitors like rotenone to validate specificity to Complex I activity.

Q2.3: What are the best approaches for studying MT-ND3 mutations in cellular models?

Studying MT-ND3 mutations in cellular models requires specialized techniques due to its mitochondrial DNA location:

  • Cybrid cell technology: Generating transmitochondrial cybrids by fusing ρ⁰ cells (depleted of mtDNA) with donor mitochondria containing the MT-ND3 mutation of interest, creating isogenic cell lines that differ only in their mitochondrial genomes.

  • Mitochondrial targeted base editing: Employing DdCBE (DddA-derived cytosine base editors) systems to introduce precise mutations in MT-ND3, as demonstrated with the G40K mutation. This approach involves designing TALE domains to target specific mtDNA regions and split DddA toxin fragments that catalyze C-to-T conversions.

  • Next-generation sequencing validation: Confirming editing efficiency and specificity by deep sequencing of targeted mtDNA regions, distinguishing between different possible editing outcomes.

  • Functional consequences assessment: Measuring Complex I activity, oxygen consumption rates, ATP production, and reactive oxygen species generation to determine physiological impacts of mutations.

These approaches enable researchers to establish causality between specific MT-ND3 variants and cellular phenotypes.

Q3.1: How can researchers utilize mitochondrial base editing to introduce specific mutations in MT-ND3?

Mitochondrial base editing for MT-ND3 requires specialized approaches due to the challenges of editing mitochondrial DNA. Based on recent advances, the following methodology has proven effective:

  • Design of DdCBE (DddA-derived cytosine base editors): This system consists of:

    • TALE domains binding to specific mtDNA sequences flanking the target site

    • Split DddA toxin fragments (G1333 or G1397) that reconstitute when brought together

    • UGI (uracil glycosylase inhibitor) to prevent repair of edited bases

  • Target site selection: Identify cytosines preceded by thymines (TC context) within the MT-ND3 gene, as these are preferred substrates for the editor.

  • Vector construction: Create separate constructs for each TALE-DddA monomer with appropriate localization signals and fluorescent markers for tracking.

  • Delivery method optimization: For in vitro studies, transient transfection with lipid-based reagents is effective. For in vivo editing, AAV (adeno-associated virus) vectors with tissue-specific promoters have shown success, with doses around 1×10¹² viral genomes per monomer.

  • Editing validation: Assess editing efficiency through:

    • Sanger sequencing for qualitative detection

    • Next-generation sequencing for quantitative analysis of editing efficiency (typically ranging from 10-43% depending on construct design and delivery method)

    • Analysis of protein expression and function to confirm phenotypic changes

When targeting the G40 position in MT-ND3, researchers achieved significant editing efficiency with the DdCBE-Nd3-9577-1 construct, resulting primarily in G40K mutations (92.5% of edited sequences).

Q3.2: What are the considerations for detecting heteroplasmy in MT-ND3 variants in different tissue types?

Detecting heteroplasmy in MT-ND3 variants requires tissue-specific considerations and specialized methodologies:

These considerations are essential for accurate assessment of MT-ND3 variants, particularly when studying the 10398A>G variant, which has been linked to numerous disease phenotypes and acts as an expression quantitative trait loci (eQTL) for MT-ND3.

Q3.3: What are the critical off-target considerations when editing MT-ND3 in mitochondrial DNA?

When editing MT-ND3 in mitochondrial DNA, researchers must implement robust off-target analysis protocols:

  • Whole mitochondrial genome sequencing: Studies have shown that DdCBE-based editing of MT-ND3 can produce C:G-to-T:A single-nucleotide variants (SNVs) across the mitochondrial genome at frequencies between 0.05-0.8%, depending on exposure time and editor design.

  • Temporal considerations: Longer mtDNA-DdCBE exposure times (weeks versus days) correspond to higher off-target rates, with neonatal mice showing approximately 5 times higher off-target frequencies (~0.8%) compared to adult mice (~0.25%) when treated with DdCBE-Nd3-9577-1.

  • Editor design optimization:

    • Testing different DddA toxin splits (G1397 and G1333) in various orientations

    • Adjusting TALE domain lengths and binding specificities

    • Incorporating high-fidelity variants of the deaminase domain

  • Quantitative assessment methods:

    • Digital droplet PCR for known potential off-target sites

    • Circular consensus sequencing (CCS) for high-accuracy detection of low-frequency variants

    • Targeted amplicon sequencing of predicted off-target regions

  • Mitochondrial health monitoring:

    • mtDNA copy number quantification to ensure editing doesn't deplete mitochondrial genomes

    • Respiratory chain complex activity measurements

    • Mitochondrial membrane potential assessment

    • ATP production and oxygen consumption rate measurements

Researchers should note that longer-term in vivo experiments require additional optimization of mitochondrial DdCBE concentration and specificity to minimize off-target effects while maintaining efficient on-target editing.

Q4.1: How do specific MT-ND3 mutations contribute to mitochondrial disease pathophysiology?

MT-ND3 mutations contribute to mitochondrial disease pathophysiology through multiple mechanisms that impact Complex I function:

MT-ND3 MutationDisease AssociationBiochemical ConsequenceCellular Impact
G40KExperimental modelAltered active/deactive state transitionDysregulated complex I activity
10398A>G (rs2853826)Multiple disease phenotypesExpression changes in MT-ND3 and MT-ND4Increased MT heteroplasmy
m.10158T>CMELAS/Leigh overlap syndromeReduced complex I assemblyDecreased NADH:ubiquinone oxidoreductase activity
m.10191T>CLeigh syndromeDestabilized Complex IIncreased ROS production
m.10197G>ALeigh syndromeImpaired proton pumpingReduced ATP synthesis

The pathophysiological mechanisms generally involve:

  • Bioenergetic deficiency: Reduced ATP production due to impaired Complex I activity, leading to energy-sensitive tissue dysfunction.

  • Increased oxidative stress: Complex I dysfunction often results in elevated reactive oxygen species (ROS) production, damaging cellular components.

  • Altered mitochondrial dynamics: Changes in fission/fusion balance and mitophagy in response to compromised respiratory chain function.

  • Tissue-specific manifestations: The heteroplasmy level of MT-ND3 mutations may vary across tissues, explaining the diverse clinical presentations. Tissues with high energy demands (brain, muscle, heart) are particularly vulnerable.

  • Compensatory mechanisms: Upregulation of alternative metabolic pathways or mitochondrial biogenesis may partially offset defects but can eventually become insufficient.

Q4.2: What animal and cellular models are most appropriate for studying MT-ND3 mutations?

Selecting appropriate models for studying MT-ND3 mutations requires consideration of specific research questions and technical feasibility:

  • Cellular Models:

    • Transmitochondrial cybrids: Created by fusing ρ⁰ cells with patient-derived platelets containing MT-ND3 mutations, providing isogenic nuclear background.

    • Lymphoblastoid cell lines (LCLs): Valuable for studying variants like 10398A>G, which has been shown to affect MT-ND3/MT-ND4 expression and associate with MT heteroplasmy.

    • Induced pluripotent stem cells (iPSCs): Can be differentiated into various cell types (neurons, cardiomyocytes) to study tissue-specific effects of MT-ND3 mutations.

    • NIH/3T3 cells: Successfully used for testing mitochondrial base editing approaches targeting MT-ND3.

  • Animal Models:

    • Mouse models with AAV-delivered base editors: Direct in vivo editing of MT-ND3 in post-mitotic tissues has been demonstrated, showing efficient introduction of mutations like G40K (10-20% editing efficiency in cardiac tissue after 24 weeks).

    • Conplastic mice: Contain mitochondria from different mouse strains on an identical nuclear background.

    • C. elegans: Simpler system for studying MT-ND3 homologs with rapid generation time.

    • Drosophila: Effective for high-throughput screening of genetic modifiers of MT-ND3 mutations.

  • Model Selection Considerations:

    • Research question (mechanistic studies vs. therapeutic development)

    • Required tissue type and developmental stage

    • Heteroplasmy levels and stability

    • Availability of appropriate controls

    • Readout systems for assessing phenotypes

For advanced research applications, combining multiple models often provides complementary insights. The recent development of in vivo mitochondrial base editing via AAV delivery represents a significant advancement for creating precise MT-ND3 mutation models.

Q4.3: How can researchers accurately assess the impact of MT-ND3 variants on Complex I function?

Comprehensive assessment of MT-ND3 variants on Complex I function requires a multi-parameter approach:

  • Enzymatic Activity Assays:

    • NADH:ubiquinone oxidoreductase activity: Spectrophotometric measurement of NADH oxidation (340nm) in the presence of ubiquinone.

    • NADH:ferricyanide oxidoreductase activity: Measures activity of the NADH dehydrogenase module independent of ubiquinone reduction.

    • Diphenyleneiodonium (DPI)-sensitive NADH oxidase activity: Assesses intact respiratory chain function.

  • Structural and Assembly Analysis:

    • Blue Native PAGE: Evaluates Complex I assembly state and abundance.

    • In-gel activity stains: Visualizes active Complex I directly in gels.

    • Immunoblotting of subunit distribution: Detects alterations in subcomplex formation.

    • Cryo-EM analysis: Reveals structural perturbations in Complex I architecture due to MT-ND3 variants.

  • Mitochondrial Function Assessment:

    • Oxygen consumption rate (OCR): Measures respiratory capacity using technologies like Seahorse XF analyzers.

    • Membrane potential measurements: Using fluorescent dyes (TMRM, JC-1) to detect changes in proton pumping efficiency.

    • ATP production: Luminescence-based assays for cellular ATP content.

    • Reactive oxygen species (ROS) production: Fluorescent probes (MitoSOX, DCF-DA) to quantify oxidative stress.

  • Omics Approaches:

    • Transcriptomics: RNA-seq analysis to identify compensatory changes in gene expression networks.

    • Proteomics: Quantitative assessment of protein abundance alterations in response to MT-ND3 variants.

    • Metabolomics: Detection of metabolic signatures associated with Complex I dysfunction.

  • Active/Deactive State Transition Analysis:

    • A/D state transition kinetics: Thermal destabilization followed by activity recovery measurements.

    • Cysteine accessibility studies: Using thiol-reactive compounds to probe conformational changes.

These methodologies should be applied comparatively between wild-type and mutant systems, with appropriate normalization to mitochondrial content or other respiratory chain complexes to isolate MT-ND3-specific effects.

Q5.1: How might MT-ND3 genetic editing be applied therapeutically for mitochondrial diseases?

Therapeutic applications of MT-ND3 genetic editing represent an emerging frontier with several promising approaches:

These approaches face significant challenges, including achieving sufficient editing efficiency, maintaining long-term effect, addressing tissue specificity, and navigating heteroplasmy dynamics. The recent demonstration of DdCBE editing in vivo suggests that with further optimization, therapeutic applications for MT-ND3-related diseases may become feasible in the future.

Q5.2: What approaches can resolve contradicting experimental data on MT-ND3 variants?

Resolving contradictory experimental data on MT-ND3 variants requires systematic methodological approaches:

  • Standardization of Experimental Systems:

    • Defined genetic backgrounds: Using isogenic cellular systems (e.g., cybrid cells) to eliminate nuclear genetic variability.

    • Controlled heteroplasmy levels: Establishing defined mutant load percentages to enable direct comparisons between studies.

    • Common reference materials: Developing shared standards for MT-ND3 variant characterization.

  • Multi-level Analysis Protocol:

    • Integrated omics approach: Combining transcriptomics, proteomics, and metabolomics data to build comprehensive models of variant effects.

    • Temporal dynamics assessment: Evaluating acute versus chronic adaptations to MT-ND3 variants.

    • Tissue-specific context evaluation: Testing variants in multiple relevant cell types, as effects may differ between tissues.

  • Advanced Statistical Methods:

    • Meta-analysis of published data: Integrating results across multiple studies to identify consistent effects and sources of variability.

    • Bayesian modeling approaches: Incorporating prior knowledge and uncertainty quantification.

    • Machine learning algorithms: Identifying patterns in complex datasets that may explain apparently contradictory results.

  • Case Study: Resolving 10398A>G Variant Effects
    A comprehensive approach to resolve contradictory data might include:

    • Cross-validation in multiple model systems (brain tissue, LCLs)

    • Parallel assessment as both an MT-ND3 and MT-ND4 eQTL

    • Evaluation of its association with MT heteroplasmy in different tissues

    • Integration of results through network analysis to identify mechanistic pathways

  • Collaborative Research Consortia:

    • Establishing multi-laboratory initiatives to test variants under standardized conditions

    • Creating shared databases of experimental results

    • Developing consensus guidelines for MT-ND3 variant classification

By implementing these approaches, researchers can better navigate the complex landscape of seemingly contradictory data and develop more reliable interpretations of MT-ND3 variant effects.

Q5.3: How can researchers integrate MT-ND3 functional data into broader mitochondrial disease research frameworks?

Integrating MT-ND3 functional data into broader mitochondrial disease frameworks requires sophisticated data integration strategies:

  • Multi-omics Data Integration:

    • Network analysis: Construction of protein-protein interaction networks to position MT-ND3 variants within the broader mitochondrial interactome.

    • Pathway enrichment analysis: Identifying dysregulated pathways associated with MT-ND3 variants, as demonstrated for the 10398A>G variant, which affects gene networks involved in mitochondrial respiratory chain and Complex I function.

    • Systems biology modeling: Developing computational models that incorporate MT-ND3 functional data into whole-mitochondrion simulations.

  • Phenotype Correlation Frameworks:

    • Genotype-phenotype databases: Contributing MT-ND3 variant functional data to resources like MitoMap and MitoMaster.

    • Clinical correlation registries: Linking biochemical findings to patient phenotypes through collaborative clinical research networks.

    • Cross-disease comparisons: Analyzing MT-ND3 variant effects across multiple mitochondrial disorders to identify common mechanisms.

  • Methodological Integration Approaches:

    Integration LevelMethodologiesExamples for MT-ND3
    MolecularStructural biology + Functional assaysCorrelating G40K mutation effects with active/deactive transition kinetics
    CellularProteomics + BioenergeticsLinking MT-ND3 expression changes to Complex I activity
    TissueTissue-specific models + ImagingComparing cardiac vs. neural effects of MT-ND3 variants
    OrganismalDisease models + Clinical dataCorrelating mouse phenotypes with human MT-ND3-related diseases
  • Translational Research Integration:

    • Biomarker development: Identifying specific signatures of MT-ND3 dysfunction that can be measured in accessible tissues or biofluids.

    • Drug repurposing screens: Using MT-ND3 variant functional data to identify compounds that may normalize affected pathways.

    • Gene therapy target identification: Leveraging integrated data to identify optimal intervention points.

  • Computational Resources Development:

    • Machine learning predictors: Training algorithms on integrated datasets to predict functional impacts of novel MT-ND3 variants.

    • Visual analytics tools: Developing interfaces to explore complex relationships between MT-ND3 function and broader mitochondrial processes.

    • Knowledge graphs: Creating navigable representations of the expanding knowledge about MT-ND3 and related mitochondrial components.

This integrated approach enables researchers to contextualize specific findings about MT-ND3 within the complex landscape of mitochondrial biology and disease, facilitating both mechanistic understanding and therapeutic development.

Q6.1: What are the most common technical challenges when working with recombinant MT-ND3, and how can they be overcome?

Working with recombinant MT-ND3 presents several technical challenges due to its hydrophobic nature and mitochondrial origin:

  • Expression Challenges:

    • Problem: Low expression yield due to toxicity

    • Solution: Use tightly controlled inducible systems (e.g., pET with T7 lysozyme co-expression), lower induction temperatures (16-20°C), and specialized E. coli strains (C41/C43) developed for membrane protein expression.

  • Protein Solubility Issues:

    • Problem: Formation of inclusion bodies

    • Solution: Expression as fusion proteins with solubility tags (MBP, SUMO, Trx), codon optimization for the expression host, and co-expression with molecular chaperones (GroEL/GroES).

  • Purification Difficulties:

    • Problem: Aggregation during extraction

    • Solution: Use mild detergents (DDM, LDAO) for solubilization, and incorporate 5-10% glycerol in all buffers to stabilize the protein.

  • Improper Folding:

    • Problem: Non-native conformation affecting functional studies

    • Solution: Optimize refolding protocols using detergent screens and implement quality control checks like circular dichroism to verify secondary structure.

  • Activity Assessment Challenges:

    • Problem: Difficulty measuring activity of isolated MT-ND3

    • Solution: Develop reconstitution systems with other Complex I subunits or use partial complex assembly approaches to assess functional contribution.

  • Antibody Generation Issues:

    • Problem: Poor immunogenicity due to high conservation

    • Solution: Design peptide antigens from variable regions, use multiple host species for antibody generation, and validate with knockout/knockdown controls.

These technical challenges can be systematically addressed through careful optimization of each step in the experimental workflow, potentially enabling more successful structural and functional studies of this challenging but critically important mitochondrial protein.

Q6.2: How should researchers interpret heteroplasmy data for MT-ND3 variants in different tissues and experimental contexts?

Interpreting heteroplasmy data for MT-ND3 variants requires consideration of several key factors:

By implementing these interpretation frameworks, researchers can more accurately assess the significance of heteroplasmy data for MT-ND3 variants across different experimental contexts.

Q6.3: What quality control measures are essential when designing experiments to study MT-ND3 mutations?

Designing robust experiments for MT-ND3 mutation studies requires comprehensive quality control measures:

  • Genetic Material Authentication:

    • DNA sequence verification: Confirm MT-ND3 sequence integrity in all experimental models using Sanger sequencing.

    • Heteroplasmy quantification: Establish baseline heteroplasmy levels using digital droplet PCR or deep sequencing.

    • Nuclear DNA background characterization: Verify isogenicity in cybrid models or account for nuclear variation in population studies.

  • Base Editing Quality Controls:

    • Off-target analysis: Sequence the entire mitochondrial genome to detect unintended edits, particularly for long-term DdCBE expression which has shown off-target rates between 0.25-0.8%.

    • Editing efficiency verification: Quantify editing rates through next-generation sequencing rather than relying solely on Sanger sequencing, which may miss low-level editing.

    • Editing pattern analysis: Distinguish between different editing outcomes (e.g., G40K vs. G40E vs. G40*) when targeting multiple adjacent cytosines.

  • Functional Validation Controls:

    • Enzyme activity normalization: Express Complex I activity relative to other respiratory chain complexes to control for mitochondrial content.

    • Positive and negative controls: Include known MT-ND3 mutants with established phenotypes and wild-type controls in all functional assays.

    • Inhibitor controls: Use specific Complex I inhibitors (rotenone, piericidin A) to confirm specificity of observed defects.

  • Experimental Design Considerations:

    • Blinding procedures: Implement blinded analysis of phenotypic outcomes to prevent bias.

    • Biological replicates: Use independent cultures, transfections, or animals rather than technical replicates.

    • Power calculations: Determine appropriate sample sizes based on expected effect sizes from preliminary data.

  • Data Reporting Standards:

    • Complete methods documentation: Report all experimental parameters including cell passage numbers, transfection efficiencies, and sequencing depth.

    • Raw data availability: Deposit sequencing data in public repositories with appropriate metadata.

    • Heteroplasmy reporting: Include detailed information on heteroplasmy levels, detection thresholds, and quantification methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.