Recombinant Bovine NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

  • Electron transport: Facilitates the first step of electron transfer from NADH to ubiquinone, establishing the proton gradient for ATP synthesis .

  • Assembly dependency: Knockdown studies in Chlamydomonas show that MT-ND4L absence disrupts complex I assembly and abolishes enzymatic activity .

  • Conservation: Structural homology with ND4L subunits in rats, cats, and humans underscores its evolutionary importance .

Research Applications

Recombinant bovine MT-ND4L is pivotal for:

  • Mitochondrial disease modeling: Linked to pathologies like Leigh syndrome and neurodegenerative disorders .

  • Enzyme kinetics: Assessing complex I inhibitors (e.g., rotenone) and redox mechanisms .

  • Structural biology: Cryo-EM studies to map proton translocation pathways .

Key Research Findings

  1. Assembly intermediates: In ND4L-deficient mutants, subcomplexes of ~200–400 kDa accumulate, indicating its role in late-stage complex I assembly .

  2. Cross-species compatibility: Bovine MT-ND4L integrates into human complex I in vitro, validating its use for translational studies .

  3. Stability: Glycerol supplementation (≥50%) prevents aggregation during long-term storage .

Limitations and Future Directions

  • Partial sequence: Current recombinant versions lack full-length coding, limiting studies on C-terminal interactions .

  • Host-specific modifications: Mammalian cell systems may better replicate native phosphorylation states .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSMVYMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This enzyme catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what role does it play in bovine mitochondria?

MT-ND4L is a gene of the mitochondrial genome that encodes the NADH-ubiquinone oxidoreductase chain 4L protein, a critical subunit of Complex I in the mitochondrial electron transport chain. This protein functions as an integral component of NADH dehydrogenase (ubiquinone), which is embedded in the inner mitochondrial membrane . Complex I represents the largest of the five respiratory chain complexes and serves as the primary entry point for electrons into the oxidative phosphorylation system.

In bovine mitochondria, MT-ND4L contributes to the hydrophobic core of Complex I's membrane domain. The protein is predominantly hydrophobic and forms part of the transmembrane region, which is essential for anchoring the complex within the inner mitochondrial membrane . This positioning is crucial for Complex I's role in creating the proton gradient necessary for ATP production.

The primary function of Complex I, to which MT-ND4L contributes, is catalyzing the first step of the electron transport process – transferring electrons from NADH to ubiquinone. This electron transfer is coupled with proton pumping across the inner mitochondrial membrane, establishing an electrochemical gradient that drives ATP synthesis . Through this mechanism, MT-ND4L plays an essential role in cellular energy metabolism, contributing to the conversion of food energy into ATP through oxidative phosphorylation.

What is the structural organization of bovine MT-ND4L?

The bovine MT-ND4L gene produces a relatively small protein of approximately 11 kDa, composed of 98 amino acids. This protein is characterized by its highly hydrophobic nature, consistent with its role as a core component of the membrane domain of Complex I . The hydrophobicity profile reflects multiple transmembrane segments that anchor the protein within the inner mitochondrial membrane.

Structurally, MT-ND4L is one of seven mitochondrially-encoded subunits that form the core of Complex I, alongside MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND5, and MT-ND6 . These mitochondrially-encoded components are predominantly found in the membrane arm of Complex I, which has an L-shaped structure consisting of a hydrophobic transmembrane domain and a hydrophilic peripheral arm containing the redox centers and NADH binding site.

An interesting feature of the MT-ND4L gene structure, similar to its human counterpart, is its genomic organization. In humans, the MT-ND4L gene spans from base pair 10,469 to 10,765 in the mitochondrial genome and exhibits an unusual 7-nucleotide overlap with the adjacent MT-ND4 gene . This overlap represents an efficient use of the compact mitochondrial genome and may have implications for the coordinated expression of these functionally related proteins.

What expression systems are most effective for producing recombinant bovine MT-ND4L?

Several expression systems have been successfully employed for the production of recombinant MT-ND4L, each with specific advantages and limitations:

The final purity of recombinant MT-ND4L protein can reach greater than or equal to 85% as determined by SDS-PAGE regardless of the expression system, though each system requires specific optimization of induction conditions, detergent selection, and purification protocols .

What are the primary challenges in working with recombinant bovine MT-ND4L and how can they be addressed?

Researchers working with recombinant bovine MT-ND4L face several significant challenges that require specialized approaches:

  • Hydrophobicity and membrane protein nature: MT-ND4L is extremely hydrophobic as it forms part of the core transmembrane region of Complex I . This makes it difficult to express in a properly folded, soluble form. Researchers can address this by:

    • Using specialized membrane protein expression systems

    • Carefully optimizing detergent selection for solubilization

    • Employing membrane-mimetic environments like nanodiscs or liposomes

    • Including fusion partners (MBP, SUMO) to improve solubility

  • Functional assessment in isolation: As MT-ND4L normally functions as part of the large Complex I assembly, assessing its activity in isolation is challenging. Strategies to overcome this include:

    • Reconstitution with other essential Complex I subunits

    • Development of specialized functional assays that can detect partial activities

    • Using biophysical methods to assess binding to known interaction partners

    • Complementation assays in Complex I-deficient cell lines

  • Protein stability issues: The protein may exhibit limited stability outside its native membrane environment, leading to aggregation or misfolding during purification. Researchers have addressed this through:

    • Maintaining optimal detergent concentrations above critical micelle concentration

    • Including stabilizing lipids in purification buffers

    • Optimizing buffer conditions (pH, ionic strength, glycerol content)

    • Reducing purification time and maintaining low temperatures

  • Proper structural characterization: Traditional structural determination techniques like X-ray crystallography are challenging for membrane proteins like MT-ND4L. Alternative approaches include:

    • Cryo-electron microscopy of reconstituted complexes

    • NMR studies of specific domains or in membrane-mimetic environments

    • Computational modeling based on homology to known structures

    • Cross-linking mass spectrometry to identify interaction surfaces

Successfully addressing these challenges requires a multifaceted approach combining specialized techniques from membrane protein biochemistry, structural biology, and functional enzymology.

How should researchers design experiments to compare wild-type and mutant forms of bovine MT-ND4L?

Designing robust experiments to compare wild-type and mutant forms of bovine MT-ND4L requires careful attention to several methodological considerations:

  • Parallel processing and matched conditions: To ensure valid comparisons, wild-type and mutant proteins should be expressed, purified, and characterized in parallel using identical protocols. This minimizes batch effects and technical variations that could be misinterpreted as biological differences . Researchers should:

    • Use the same expression system and cell batch

    • Purify proteins simultaneously with identical buffers and conditions

    • Perform analytical characterizations in the same experimental run

  • Multi-parameter assessment framework: A comprehensive comparison should evaluate multiple aspects of protein structure and function, including:

    • Expression levels and solubility

    • Complex I assembly competence (using BN-PAGE)

    • NADH:ubiquinone oxidoreductase activity

    • Proton pumping efficiency

    • ROS production

    • Protein stability (thermal shift assays)

    • Structural integrity (circular dichroism, limited proteolysis)

  • Appropriate controls and normalization: Essential controls should include:

    • Known functional mutants as positive controls for dysfunction

    • Non-conserved residue mutations as controls for general perturbation effects

    • Normalization of activity to the amount of properly assembled complex rather than total protein

    • Internal standards for cross-experiment calibration

  • Robust statistical analysis: Experiments should be designed with:

    • Minimum of three biological replicates (different protein preparations)

    • Appropriate technical replicates within each biological replicate

    • Statistical tests appropriate to the data distribution

    • Correction for multiple comparisons when screening numerous mutations

  • Structure-function correlation: Interpretation should connect experimental observations to structural context by:

    • Mapping mutation sites onto available structural models

    • Considering the local environment of the mutated residue

    • Evaluating conservation across species

    • Relating findings to known pathogenic mutations in human MT-ND4L

This systematic approach enables reliable comparisons between wild-type and mutant forms of MT-ND4L, providing insights into structure-function relationships and potential disease mechanisms associated with specific variants .

What analytical techniques are most effective for characterizing the structure and function of recombinant bovine MT-ND4L?

A comprehensive characterization of recombinant bovine MT-ND4L requires multiple complementary analytical techniques to assess its structural integrity, functional properties, and interactions:

  • Structural Analysis Techniques:

    • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements and can confirm proper protein folding in various detergent or lipid environments.

    • Cryo-Electron Microscopy: Increasingly used for membrane protein structural determination, enabling visualization of MT-ND4L within the context of Complex I .

    • Cross-linking Mass Spectrometry: Identifies interaction interfaces at amino acid resolution, providing spatial constraints for structural modeling.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Offers insights into protein dynamics and solvent accessibility of different regions.

  • Biochemical Characterization:

    • SDS-PAGE and Western Blotting: For purity assessment and specific detection of the protein.

    • Size Exclusion Chromatography: Evaluates oligomeric state and homogeneity.

    • Blue Native PAGE: Assesses incorporation into Complex I or subcomplexes.

    • Mass Spectrometry: Confirms protein identity, molecular weight, and post-translational modifications .

  • Functional Assays:

    • NADH:Ubiquinone Oxidoreductase Activity: Spectrophotometric monitoring of NADH oxidation (λ = 340 nm) with natural ubiquinone or artificial electron acceptors.

    • Proton Translocation Measurements: Using pH-sensitive fluorescent dyes (ACMA, pyranine) in reconstituted proteoliposomes.

    • Reactive Oxygen Species Detection: Amplex Red assay for hydrogen peroxide or MitoSOX for superoxide detection.

    • Thermal Stability Assays: To assess complex integrity and the impact of mutations or ligands.

  • Interaction Studies:

    • Surface Plasmon Resonance (SPR): Measures binding kinetics with potential interaction partners.

    • Microscale Thermophoresis (MST): Detects interactions based on changes in thermophoretic mobility, working well with membrane proteins.

    • Co-immunoprecipitation: Identifies protein-protein interactions within the complex or with other cellular components.

  • Reconstitution Approaches:

    • Proteoliposome Preparation: Incorporation into defined lipid bilayers for functional studies.

    • Nanodisc Assembly: Creates a more controlled membrane environment for structural and functional studies.

    • Complex I Reconstitution: Combining with other purified subunits to restore native-like activity .

These complementary techniques provide a comprehensive characterization of recombinant bovine MT-ND4L, enabling researchers to connect structural features to functional properties and understand the impact of mutations or experimental conditions.

How does the interaction between MT-ND4L and other Complex I subunits influence electron transport chain function?

The interaction between MT-ND4L and other Complex I subunits represents a critical aspect of electron transport chain function, with several key mechanisms:

Understanding these interactions has significant implications for comprehending both the fundamental mechanisms of bioenergetics and the molecular basis of mitochondrial disorders associated with Complex I dysfunction .

What is the molecular mechanism by which mutations in MT-ND4L affect Complex I assembly and function?

Mutations in MT-ND4L can impact Complex I assembly and function through several distinct molecular mechanisms, providing insights into both fundamental bioenergetic processes and the pathogenesis of mitochondrial disorders:

Understanding these molecular mechanisms provides a framework for classifying MT-ND4L mutations based on their primary effects, potentially guiding therapeutic approaches for mitochondrial disorders associated with Complex I dysfunction .

How does MT-ND4L contribute to reactive oxygen species (ROS) production in mitochondria?

Complex I is a major site of reactive oxygen species (ROS) production in mitochondria, and MT-ND4L's position and function within this complex influence ROS generation through several mechanisms:

Understanding MT-ND4L's contribution to ROS production has significant implications for mitochondrial disorders and age-related diseases where oxidative stress plays a crucial role in pathogenesis .

What are the optimal protocols for expressing and purifying recombinant bovine MT-ND4L?

Expressing and purifying recombinant bovine MT-ND4L requires specialized approaches to address the challenges associated with this hydrophobic membrane protein:

Expression System Selection and Optimization:

  • E. coli Expression System Protocol:

    • Use C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • Employ low-copy number vectors with tightly regulated promoters (pET or pBAD series)

    • Include an N-terminal fusion tag (His6, MBP, or SUMO) to aid purification

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce with low IPTG concentration (0.1-0.5 mM) at reduced temperature (16-25°C)

    • Continue expression for 16-20 hours

    • The protein may form inclusion bodies, requiring specialized refolding protocols

  • Yeast Expression System (Pichia pastoris):

    • Clone gene into vectors with methanol-inducible promoters

    • Transform into GS115 or KM71 strains

    • Culture in glycerol-containing medium until high cell density

    • Induce expression by methanol addition (0.5%)

    • Continue induction for 24-72 hours with periodic methanol addition

    • This system often yields properly folded membrane proteins

  • Insect Cell Expression (Baculovirus):

    • Generate recombinant bacmid containing MT-ND4L gene

    • Transfect Sf9 or Hi5 cells to produce viral stock

    • Infect cells at MOI of 1-5

    • Harvest cells 48-72 hours post-infection

    • This system provides eukaryotic protein processing capabilities

Purification Protocol for Detergent-Solubilized MT-ND4L:

  • Cell Lysis and Membrane Preparation:

    • Resuspend cells in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, protease inhibitors

    • Disrupt cells by sonication or French press

    • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 min)

    • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Resuspend membrane pellet in solubilization buffer

  • Protein Solubilization:

    • Screen detergents systematically; common effective options include:

      • n-Dodecyl-β-D-maltoside (DDM): 1-2% (w/v)

      • Lauryl maltose neopentyl glycol (LMNG): 0.5-1% (w/v)

      • Digitonin: 1-2% (w/v)

    • Include 20% glycerol and 1 mM DTT for stability

    • Solubilize with gentle agitation for 1-2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

  • Affinity Purification:

    • Apply solubilized material to appropriate affinity resin:

      • Ni-NTA for His-tagged protein

      • Amylose resin for MBP fusion proteins

    • Use binding buffer containing detergent at concentration above CMC

    • Wash extensively to remove non-specifically bound proteins

    • Elute with appropriate competing agent (imidazole, maltose)

    • Consider on-column tag cleavage if a protease site is included

  • Size Exclusion Chromatography:

    • Further purify by gel filtration using Superdex 200 or similar

    • Use running buffer containing detergent at 2-3× CMC

    • Collect fractions corresponding to monomeric protein

    • Assess purity by SDS-PAGE (achieving ≥85% purity)

  • Alternative: Nanodisc Incorporation:

    • Mix purified protein with membrane scaffold protein and lipids

    • Remove detergent using Bio-Beads or dialysis

    • This provides a more native-like membrane environment

This protocol can yield purified recombinant bovine MT-ND4L with purity ≥85% as determined by SDS-PAGE, suitable for functional and structural studies .

How can researchers effectively incorporate recombinant bovine MT-ND4L into functional assays?

Incorporating recombinant bovine MT-ND4L into functional assays requires strategies to ensure its proper integration into experimental systems that can report on specific aspects of its function:

Reconstitution Approaches:

  • Proteoliposome Preparation Protocol:

    • Prepare lipid mixture mimicking inner mitochondrial membrane composition:

      • 70-80% phosphatidylcholine

      • 15-20% phosphatidylethanolamine

      • 5-10% cardiolipin

    • Dissolve lipids in chloroform, dry under nitrogen, and resuspend in buffer

    • Form unilamellar vesicles by extrusion through polycarbonate filters

    • Add detergent-solubilized MT-ND4L (alone or with other Complex I subunits)

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation by flotation assay or freeze-fracture electron microscopy

  • Nanodisc Assembly for Controlled Studies:

    • Mix purified MT-ND4L with membrane scaffold protein (MSP) and selected lipids

    • Optimize MT-ND4L:MSP:lipid ratios (typically 1:2:60-120)

    • Remove detergent gradually using Bio-Beads

    • Purify assembled nanodiscs by size exclusion chromatography

    • This system provides a defined membrane environment with both sides accessible

  • Co-expression with Partner Subunits:

    • Co-express MT-ND4L with interacting Complex I subunits

    • Use multi-cistronic expression vectors or co-transformation strategies

    • This approach may yield partially assembled subcomplexes with measurable activities

Functional Assay Methodologies:

  • NADH:Ubiquinone Oxidoreductase Activity Assay:

    • Buffer composition: 50 mM potassium phosphate pH 7.4, 2 mM KCN, 70 μM ubiquinone-1

    • Add reconstituted proteoliposomes or nanodiscs containing MT-ND4L (± other subunits)

    • Initiate reaction by adding NADH (final concentration 100 μM)

    • Monitor NADH oxidation spectrophotometrically at 340 nm (ε = 6.22 mM⁻¹cm⁻¹)

    • Calculate activity as nmol NADH oxidized/min/mg protein

    • Include rotenone (5 μM) in parallel reactions to determine Complex I-specific activity

  • Proton Pumping Assay Using ACMA Fluorescence:

    • Suspend proteoliposomes in buffer (10 mM HEPES pH 7.2, 100 mM KCl)

    • Add ACMA fluorescent dye (final concentration 0.5 μM)

    • Establish baseline fluorescence (excitation 410 nm, emission 480 nm)

    • Initiate reaction by adding NADH (final concentration 100 μM)

    • Monitor fluorescence quenching (indicating proton pumping)

    • Add uncoupler (CCCP, 5 μM) to dissipate gradient and confirm specificity

    • Calculate initial rate of fluorescence quenching as measure of proton pumping

  • ROS Production Measurement Using Amplex Red:

    • Buffer: 50 mM potassium phosphate pH 7.4, containing Amplex Red (50 μM) and HRP (0.1 U/ml)

    • Add reconstituted MT-ND4L-containing samples

    • Initiate reaction with NADH (100 μM)

    • Monitor fluorescence increase (excitation 560 nm, emission 590 nm)

    • Calculate H₂O₂ production rate using standard curve

    • Perform parallel reactions with SOD to convert all superoxide to H₂O₂

  • Binding and Interaction Studies Using MST or SPR:

    • Label purified MT-ND4L with fluorescent dye (for MST) or immobilize on sensor chip (for SPR)

    • Flow potential interaction partners at varying concentrations

    • Measure binding through thermophoretic mobility changes (MST) or resonance shifts (SPR)

    • Calculate binding constants (KD) from resulting data

    • This approach identifies specific interactions with other Complex I subunits or small molecules

These methodologies enable researchers to assess different aspects of MT-ND4L function, from its contribution to Complex I enzymatic activity to its role in proton pumping and ROS production, providing comprehensive insights into its biological role .

What approaches are most effective for studying the effects of mutations in bovine MT-ND4L?

Studying the effects of mutations in bovine MT-ND4L requires comprehensive approaches that combine molecular biology, biochemistry, and advanced biophysical techniques:

Mutation Design and Creation Strategies:

  • Site-Directed Mutagenesis Approach:

    • Design primers containing desired mutations using overlapping or back-to-back strategies

    • Perform PCR-based mutagenesis on expression vectors containing MT-ND4L

    • Verify mutations by sequencing before expression

    • Create systematically designed mutation libraries targeting:

      • Conserved residues identified through evolutionary analysis

      • Disease-associated mutations found in human MT-ND4L

      • Structure-based predictions of functionally important sites

      • Scanning mutagenesis of transmembrane regions

  • Expression System Considerations:

    • Express wild-type and mutant proteins in parallel using identical conditions

    • Quantify expression levels to identify mutations affecting protein stability

    • For mitochondrially-encoded proteins like MT-ND4L, consider allotopic expression (nuclear expression with mitochondrial targeting) for mammalian studies

Functional and Structural Characterization:

  • Multi-parameter Assessment Protocol:

    • Assembly analysis: Use Blue Native PAGE to assess incorporation into Complex I or subcomplexes

    • Activity measurements: Determine NADH:ubiquinone oxidoreductase activity of each mutant

    • Proton pumping efficiency: Measure proton translocation using pH-sensitive dyes

    • ROS production: Quantify superoxide or hydrogen peroxide generation

    • Thermal stability: Perform thermal shift assays to assess complex stability

    • Structural integrity: Use limited proteolysis or HDX-MS to detect conformational changes

  • Data Organization Framework:

    • Create comprehensive mutation effect profiles using normalized values for each parameter

    • Develop heat maps or radar plots to visualize multi-parameter effects

    • Cluster mutations based on similarity of their functional profiles

    • This approach helps identify functional domains and mechanistic classes of mutations

Analysis and Interpretation Methodologies:

  • Structure-Function Mapping:

    • Map mutations onto available structural models of Complex I

    • Correlate functional effects with structural features like:

      • Proximity to subunit interfaces

      • Distance from electron transfer cofactors

      • Position relative to proposed proton channels

      • Location in membrane-spanning regions

  • Severity Classification System:

    • Establish quantitative criteria for classifying mutation severity

    • Consider developing a multi-parameter scoring system weighted for critical functions

    • Example classification table framework:

Severity ClassActivity RetentionComplex AssemblyProton PumpingROS ProductionInterpretation
Class 1 (Mild)>70%>80%>60%<150%Minimal functional impact
Class 2 (Moderate)30-70%50-80%30-60%150-250%Partial dysfunction
Class 3 (Severe)<30%<50%<30%>250%Major functional defect
  • Mechanistic Insights from Combined Analysis:

    • Group mutations based on their predominant effect (assembly, catalysis, coupling)

    • Identify potential functional domains based on clustering of similar mutation effects

    • Develop mechanistic hypotheses explaining how specific residues contribute to function

    • Design second-generation mutations to test these hypotheses

This systematic approach enables comprehensive characterization of MT-ND4L mutations, providing insights into structure-function relationships, potential disease mechanisms, and fundamental aspects of Complex I function .

How should researchers analyze enzyme kinetics data from experiments involving recombinant bovine MT-ND4L?

Analyzing enzyme kinetics data from experiments involving recombinant bovine MT-ND4L requires specialized approaches that account for the protein's membrane-bound nature and its function within a multi-subunit complex:

Kinetic Parameter Determination:

  • Basic Michaelis-Menten Analysis:

    • Generate initial velocity data across a range of substrate concentrations

    • Plot reaction velocity vs. substrate concentration

    • Fit data to the Michaelis-Menten equation: v=Vmax×[S]/(KM+[S])v = V_{max} \times [S] / (K_M + [S])

    • Extract KM (Michaelis constant) and Vmax (maximum velocity)

    • Calculate kcat (turnover number) by dividing Vmax by enzyme concentration

    • Determine catalytic efficiency (kcat/KM) as a measure of enzyme performance

  • Data Transformation Approaches:

    • Lineweaver-Burk (double-reciprocal) plot: 1/v1/v vs. 1/[S]1/[S]

    • Eadie-Hofstee plot: vv vs. v/[S]v/[S]

    • Hanes-Woolf plot: [S]/v[S]/v vs. [S][S]

    • These transformations can reveal deviations from standard Michaelis-Menten kinetics

  • Example Kinetic Data Analysis (NADH Oxidation by Reconstituted Complex I):

NADH Concentration (μM)Activity (μmol/min/mg)Lineweaver-Burk (1/μM, min·mg/μmol)
50.320.200, 3.125
100.580.100, 1.724
251.150.040, 0.870
501.760.020, 0.568
1002.43

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.