Recombinant Bovine Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

Shipped with Ice Packs
In Stock

Description

Functional Significance in nAChRs

The α5 subunit does not directly bind acetylcholine but critically influences receptor properties:

  • Calcium Permeability: Enhances Ca²⁺ influx in α3β4-containing receptors .

  • Sensitivity Modulation: Increases acetylcholine sensitivity in α3β2/β4 receptors but not α4β2 combinations .

  • Desensitization Rates: Accelerates receptor deactivation in specific subunit configurations .

In bovine models, α5-containing nAChRs likely modulate neurotransmission in brain regions like the hippocampus and striatum, analogous to human and rodent systems .

Key Findings from Studies

  • Behavioral Modulation: Deletion of α5 in rodents enhances ethanol-induced hypnosis and anxiolytic effects, suggesting its role in addiction pathways .

  • Genetic Variants: The D398N polymorphism (analogous to human rs16969968) alters receptor maximal response to agonists (e.g., 50% reduction in α4β2α5N398 vs. α4β2α5D398) .

  • Disease Associations: Linked to nicotine dependence, lung cancer, and chronic obstructive pulmonary disease in genome-wide studies .

Experimental Use Cases

  • Receptor Trafficking: Used to study α5’s role in stabilizing α4β2 receptors on cell membranes .

  • Electrophysiology: Employed in Xenopus oocyte models to quantify ion currents and desensitization kinetics .

Limitations and Future Directions

Current challenges include low expression yields in non-mammalian systems and limited bovine-specific functional data. Future work may focus on:

  • High-resolution cryo-EM structures of bovine α5-containing receptors.

  • CRISPR-engineered bovine models to study in vivo receptor dynamics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CHRNA5; Neuronal acetylcholine receptor subunit alpha-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-475
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CHRNA5
Target Protein Sequence
RWGPEGAGGGVRRGLAEPSVVAKHEDSLFKDLFQDYERWVRPVEHLNDRIKIKFGLAISQ LVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKLIRVPSDSLWTPDIVLFDNADGR FEGASTKTVVRYDGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIIL EDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCI GLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMI FVTLSIMVTVFAINIHHRSSSTHDAMAPWVRKIFLHKLPKLLCMRSHVDRYFSQKEEARS SRGPRSSRNALEAALDSVRYITRHVMKETDVREVVEDWKFIAQVLDRMFLWTFLLVSVVG SLGLFVPVIYKWANIIVPIHIGNENK
Uniprot No.

Target Background

Function

Upon acetylcholine binding, the AChR undergoes a significant conformational change impacting all subunits. This change leads to the opening of an ion channel across the plasma membrane.

Database Links

KEGG: bta:282177

STRING: 9913.ENSBTAP00000055853

UniGene: Bt.9979

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-5/CHRNA5 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of CHRNA5?

CHRNA5 (Neuronal acetylcholine receptor subunit alpha-5) is an essential subunit of the nicotinic acetylcholine receptor (nAChR). It functions as an accessory subunit rather than a primary binding site for acetylcholine. After acetylcholine binding, the AChR undergoes an extensive conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane . The protein has a predicted molecular weight of approximately 53 kDa and contains specific binding domains that facilitate protein-protein interactions with other receptor subunits and signaling molecules .

For effective research with bovine CHRNA5, it's important to note that while the protein's core functions are conserved across species, sequence variations exist that may affect antibody recognition and functional properties in experimental systems.

How does CHRNA5 differ structurally from other nicotinic receptor subunits?

CHRNA5 serves distinctively as an accessory subunit within nicotinic receptors. Unlike primary subunits that directly bind acetylcholine, CHRNA5 modulates receptor function through protein-protein interactions. Structural analysis reveals that CHRNA5 contains specific amino acid residues (including ILE 259, CYS 283, TYR 273, and THR 404) that form critical hydrogen bonds with other proteins, such as CES1 . These interaction sites contribute to the unique modulatory role of CHRNA5.

Research with recombinant bovine CHRNA5 should consider these key structural elements while accounting for potential species-specific variations in these binding regions.

What are the recommended methods for expressing and purifying recombinant bovine CHRNA5?

For successful expression and purification of recombinant bovine CHRNA5, researchers should consider a multi-phase approach:

  • Expression System Selection: While the search results don't specifically detail bovine CHRNA5 expression, research on human CHRNA5 indicates successful expression in various systems including Xenopus oocytes, mammalian cell lines (particularly HEK293), and neurons derived from human induced pluripotent stem cells (iPSCs) . For bovine CHRNA5, mammalian expression systems are likely to provide better post-translational modifications compared to bacterial systems.

  • Purification Strategy: A two-step purification protocol is typically recommended:

    • Initial capture using affinity chromatography (His-tag or GST-tag systems)

    • Secondary purification via size exclusion chromatography to achieve >95% purity

  • Validation Methods: Western blotting using anti-CHRNA5 antibodies (with verified cross-reactivity to bovine CHRNA5) at approximately 1 μg/mL concentration . The predicted 53 kDa band should be confirmed against appropriate positive controls.

When working with membrane proteins like CHRNA5, incorporating detergents such as CHAPS or DDM in your buffers is essential for maintaining protein solubility and native conformation throughout the purification process.

What are the optimal conditions for studying CHRNA5 protein-protein interactions?

Based on research with human CHRNA5, optimal conditions for studying protein-protein interactions of bovine CHRNA5 would include:

  • Co-immunoprecipitation (Co-IP) Analysis: Use RIPA buffer with protease inhibitors for cell lysis, followed by immunoprecipitation with anti-CHRNA5 antibodies . Kelly cell lysate has been successfully used at 35 μg for western blot detection .

  • Molecular Docking Studies: As demonstrated with CHRNA5-CES1 interactions, utilize rigid protein-protein docking through servers like GRAMM-X, with protein structure files obtained from databases such as Alphafold or generated through homology modeling using I-TASSER . Key parameters for successful docking include:

    ParameterRecommended Setting
    Docking Rounds3000+
    Energy Threshold<-500 units for stable interaction
    Binding Surface Area>2000 Ų for significant interaction
    Binding Energy<-25 kcal/mol for stable binding
  • Molecular Dynamics Simulations: For in-depth analysis of interaction stability, employ Gromacs (v2022.3 or later) with GAFF force field implementation via AmberTools. Critical analytical measurements should include RMSD, RMSF, protein gyration radius (Rg), and solvent-accessible surface area (SASA) .

The validation of interactions should include mutational analysis of predicted binding sites (e.g., converting key residues to alanine) to confirm the specificity and strength of the interaction .

How do genetic polymorphisms affect CHRNA5 expression and function?

Genetic polymorphisms in CHRNA5 significantly impact both expression levels and functionality of the receptor. While most research has focused on human CHRNA5, the mechanisms likely apply to bovine CHRNA5 with species-specific variations.

  • Promoter Region Polymorphisms: Three key haplotypes (delTTC, insATC, and insTGG) in the 5' promoter region of CHRNA5 have been identified to significantly affect transcript levels . The delTTC haplotype is associated with the highest CHRNA5 transcript levels (relative quantification = 1.82), while the insTGG haplotype correlates with the lowest expression (relative quantification = 0.88) .

  • Functional Impact on Disease Risk: The insTGG haplotype shows strong linkage disequilibrium with three risk alleles associated with nicotine dependence, lung cancer, and chronic obstructive pulmonary disease in humans . This suggests that polymorphisms affecting expression levels have significant downstream functional consequences.

  • Experimental Validation: Luciferase reporter assays in multiple cell lines (A549, H460, H520, and H596) confirm that 5' region haplotypes significantly alter CHRNA5 promoter activity, while 3'-untranslated region variants show minimal effect .

For bovine CHRNA5 research, investigators should consider characterizing analogous polymorphisms in cattle and their potential effects on protein expression and function in various tissues.

What techniques are most effective for quantifying CHRNA5 expression levels in different tissue samples?

For accurate quantification of bovine CHRNA5 expression across different tissues, a multi-method approach is recommended:

  • RNA Level Quantification:

    • RT-qPCR: The gold standard for transcript quantification, as used in studies of human CHRNA5 . Ensure high RNA integrity (RIN values ≥8) for reliable results. Design primers specific to bovine CHRNA5 with amplification efficiency between 90-110%.

    • RNA-Seq: For transcriptome-wide analysis with high sensitivity. In human studies, RNA-Seq successfully identified differential expression of over 17,800 genes, including CHRNA5 .

  • Protein Level Quantification:

    • Western Blotting: Use validated antibodies with confirmed bovine cross-reactivity. Optimal antibody concentration is approximately 1 μg/mL based on human CHRNA5 studies .

    • Immunohistochemistry: Effective for tissue localization studies. Human CHRNA5 has been successfully detected in formalin-fixed, paraffin-embedded tissues at antibody concentrations of 3.75 μg/ml .

  • Normalization Strategy:

    Sample TypeRecommended Reference Genes
    Neural TissueGAPDH, β-actin, HPRT
    Lung Tissue18S rRNA, PPIA, TBP
    Mixed Tissue AnalysisGeometric mean of multiple reference genes

When comparing expression across different tissues, employ a minimum of three biological replicates and three technical replicates per sample to ensure statistical reliability.

How can I design experiments to study the role of CHRNA5 in specific signaling pathways?

To effectively investigate bovine CHRNA5's role in signaling pathways, consider this comprehensive experimental design approach:

  • Gene Knockdown/Knockout Strategies:

    • shRNA Knockdown: As demonstrated in CHRNA5-CES1 interaction studies , design at least 3 shRNA constructs targeting different regions of bovine CHRNA5 mRNA.

    • CRISPR-Cas9: For complete knockout studies, design guide RNAs with minimal off-target effects. Validate knockout efficiency at both mRNA (RT-qPCR) and protein (Western blot) levels.

  • Pathway Analysis Design:

    • Experimental Groups: Include multiple control groups as demonstrated in nicotine studies: NC (control), SH (knockdown), SH + IN (knockdown + inhibitor) .

    • Transcriptomic Analysis: RNA-Seq followed by GO (Gene Ontology) and KEGG (Kyoto Encyclopedia of Genes and Genomes) enrichment analysis to identify affected pathways. Previous studies identified MAPK signaling as significantly affected by CHRNA5 modulation .

  • Validation Experiments:

    • Phosphorylation Assays: Western blot with phospho-specific antibodies to validate activation/inhibition of key pathway components.

    • Pathway Inhibitors: Include specific inhibitors (e.g., PD98059 for MEK/ERK pathway) to confirm pathway involvement .

  • Data Analysis Strategy:

    • Apply multivariate analysis to distinguish direct from indirect effects

    • Utilize time-course experiments to establish causality in signaling cascades

This design provides a framework for systematically dissecting the role of bovine CHRNA5 in various signaling pathways while incorporating appropriate controls to ensure result validity.

What are the current challenges in studying CHRNA5 protein conformation changes upon ligand binding?

Studying CHRNA5 conformational changes presents several methodological challenges:

  • Technical Limitations:

    • Membrane Protein Crystallization: The transmembrane nature of CHRNA5 makes traditional X-ray crystallography challenging.

    • Dynamic Conformational States: CHRNA5 undergoes extensive conformational changes affecting all subunits upon ligand binding , requiring techniques that capture protein dynamics rather than static structures.

  • Methodological Approaches and Limitations:

    TechniqueStrengthsLimitations for CHRNA5
    Cryo-EMHigh resolution of membrane proteinsChallenging for dynamic transitions
    FRETReal-time conformational changesRequires strategic fluorophore placement
    MD SimulationsDetailed atomistic dynamicsDependence on accurate starting structures
    HDX-MSMaps solvent-accessible regionsLimited spatial resolution
  • Integration Challenges:

    • Reconciling data from different techniques with varying temporal and spatial resolutions

    • Distinguishing CHRNA5-specific conformational changes from those of other subunits in the pentameric receptor

  • Future Directions:

    • Development of nanobodies specific to different CHRNA5 conformational states

    • Application of time-resolved cryo-EM to capture transition states

    • Incorporation of AI/ML approaches to predict conformational changes based on multiple data sources

Researchers should consider combining computational approaches (molecular dynamics simulations with GAFF force field using AmberTools ) with experimental validation through techniques like site-directed mutagenesis of predicted key residues involved in the conformational changes.

How does CHRNA5 interact with CES1, and what methodologies best characterize this interaction?

The interaction between CHRNA5 and CES1 represents a significant area for investigation, with potential implications for understanding receptor function and regulation. Based on human studies, similar interactions may exist with bovine proteins.

  • Interaction Characteristics:

    • CHRNA5 and CES1 form a stable protein complex with a docking surface area of 2049.3 Ų and binding energy of -26.3 kcal/mol .

    • Specific hydrogen bonds form between key amino acid residues: ILE 259-ASN 211, CYS 283-LYS 498, TYR 273-ASP 126, and THR 404-PHE 6 .

  • Optimal Methodologies for Characterization:

    a. Computational Approaches:

    • Protein-protein docking using GRAMM-X server with receptor (CHRNA5) and ligand (CES1) structures from databases like Alphafold or I-TASSER .

    • Molecular dynamics simulations using Gromacs to evaluate stability through RMSD, RMSF, Rg, and SASA measurements .

    b. Experimental Validation:

    • Co-immunoprecipitation to confirm physical interaction in cellular contexts

    • Mutagenesis of key interaction residues (to alanine) followed by binding assays to confirm the importance of specific amino acids .

    • Proximity ligation assays to visualize interactions in situ

  • Functional Relevance Assessment:

    • Transcriptomic analysis after CHRNA5 knockdown reveals significant downregulation of CES1, suggesting functional consequences of this interaction .

    • Pathway analysis indicates involvement in MAPK signaling and ERK pathways .

For bovine protein studies, sequence alignments should first be performed to identify conservation of key interaction residues before embarking on detailed interaction studies.

What other protein partners interact with CHRNA5 and how do these interactions affect receptor function?

CHRNA5 engages in multiple protein-protein interactions that collectively modulate receptor assembly, trafficking, and signaling functions:

  • Receptor Subunit Interactions:

    • CHRNA5 primarily interacts with other nicotinic receptor subunits, particularly in the CHRNA5-CHRNA3-CHRNB4 cluster .

    • These interactions are critical for proper receptor assembly and function, with the CHRNA5-CHRNA3-CHRNB4 genes showing extensive linkage disequilibrium .

  • Regulatory Protein Interactions:

    • Beyond CES1, CHRNA5 interacts with various regulatory proteins that affect its function and expression.

    • Transcription factors binding to the CHRNA5 promoter region can be altered by polymorphisms, affecting expression levels .

  • Signaling Pathway Components:

    • CHRNA5 modulation affects MAPK signaling pathway components as revealed by KEGG enrichment analysis .

    • Interactions with post-translational protein phosphorylation machinery as indicated by Reactome enrichment analysis .

  • Methodologies for Identification of Novel Interactions:

    TechniqueApplicationKey Considerations
    Proximity-dependent Biotin Identification (BioID)Identifies proximal proteins in living cellsRequires fusion protein expression
    Affinity Purification-Mass SpectrometryIdentifies stable binding partnersMay miss transient interactions
    Yeast Two-Hybrid ScreeningLarge-scale interaction screeningHigh false positive rate
    Cross-linking Mass SpectrometryCaptures transient interactionsComplex data analysis

For bovine CHRNA5 research, comparative interactomics approaches may help leverage existing human data while identifying species-specific interaction partners.

How do promoter variants affect CHRNA5 transcription and what experimental approaches best characterize these effects?

Promoter variants significantly impact CHRNA5 transcription through alterations in transcription factor binding sites. Based on human studies, similar mechanisms likely exist in bovine CHRNA5.

  • Characterized Promoter Variants:

    • Three major haplotypes in the 5' promoter region (delTTC, insATC, and insTGG) have been identified and significantly affect CHRNA5 expression levels .

    • The delTTC haplotype correlates with highest expression (relative quantification = 1.82), while insTGG yields lowest expression (relative quantification = 0.88) .

  • Optimal Experimental Approaches:

    a. Reporter Gene Assays:

    • Luciferase reporter constructs containing different promoter haplotypes transfected into relevant cell lines (e.g., neuronal or lung cell lines for CHRNA5) .

    • Quantitative measurement of promoter activity under various conditions, including exposure to relevant stimuli.

    b. Transcription Factor Binding Analysis:

    • Electrophoretic Mobility Shift Assays (EMSA) to assess differences in transcription factor binding between variants.

    • Chromatin Immunoprecipitation (ChIP) to confirm in vivo binding of specific transcription factors to variant promoters.

    c. Functional Impact Assessment:

    • qRT-PCR measurement of endogenous CHRNA5 expression in tissues/cells with different promoter haplotypes .

    • Correlation of expression differences with functional outcomes in relevant biological systems.

  • Data Analysis Strategy:

    • Multiple linear regression analysis to identify independent effects of individual variants within haplotypes

    • Integration of expression data with functional outcomes to establish biological significance

This comprehensive approach enables researchers to establish clear causal relationships between promoter variants and CHRNA5 expression levels, with potential implications for understanding receptor function in different physiological contexts.

What bioinformatic approaches are most useful for analyzing CHRNA5 genetic variation across species?

For comprehensive cross-species analysis of CHRNA5 genetic variation, a multi-layered bioinformatic approach is recommended:

  • Sequence Homology and Conservation Analysis:

    • Multiple sequence alignment (MSA) of CHRNA5 coding regions across species using MUSCLE or CLUSTALW algorithms.

    • Identification of highly conserved regions suggesting functional importance, particularly in transmembrane domains and ligand-binding interfaces.

    • Calculation of conservation scores (e.g., Jensen-Shannon divergence) to quantify evolutionary constraints.

  • Structural Variation Analysis:

    • Homology modeling of CHRNA5 across species using I-TASSER or SWISS-MODEL .

    • Comparative structural analysis to identify species-specific differences in protein folding and interaction surfaces.

    • Molecular dynamics simulations to assess functional implications of structural differences.

  • Regulatory Region Analysis:

    Analysis TypeToolsKey Outputs
    Promoter ConservationPhyloP, PhastConsConservation scores across species
    TFBS PredictionJASPAR, TRANSFACPredicted transcription factor binding sites
    Epigenetic ComparisonENCODE data integrationSpecies-specific regulatory patterns
  • Functional Prediction:

    • Machine learning approaches (SIFT, PolyPhen) to predict functional impacts of variants.

    • Network analysis to assess conservation of protein-protein interaction networks between species.

    • Integration with expression datasets to correlate genetic variation with expression differences.

  • Visualization and Integration:

    • Circos plots for visualizing conservation patterns across species.

    • Heatmaps for comparative expression analysis.

    • Integrated genome browsers for multi-species alignment visualization.

This comprehensive bioinformatic framework enables researchers to systematically characterize CHRNA5 variation across species, providing insights into evolutionary conservation, species-specific adaptations, and potential functional implications of observed genetic differences.

How can recombinant bovine CHRNA5 be utilized in comparative studies with human CHRNA5 for neuropharmacological research?

Recombinant bovine CHRNA5 offers valuable opportunities for comparative studies with human CHRNA5, particularly in neuropharmacological research:

  • Comparative Binding Studies:

    • Parallel pharmacological profiling of bovine and human CHRNA5-containing receptors to identify species-specific differences in ligand affinities and receptor kinetics.

    • Development of radioligand binding assays using purified recombinant proteins to quantify binding parameters (Kd, Bmax) for various compounds.

    • Identification of conserved and divergent binding pockets through cross-species structural analysis.

  • Functional Comparative Analysis:

    • Electrophysiological characterization (patch-clamp recordings) of receptors containing either bovine or human CHRNA5 to assess:

      • Channel opening kinetics

      • Desensitization properties

      • Response to various agonists and antagonists

    • Calcium imaging studies to compare downstream signaling responses

  • Structural Determinants of Function:

    • Creation of chimeric receptors containing domains from both bovine and human CHRNA5 to identify regions responsible for functional differences.

    • Site-directed mutagenesis to convert species-specific amino acids and assess their impact on receptor properties.

    • Molecular dynamics simulations to predict structural basis for observed functional differences .

  • Translational Applications:

    ApplicationApproachPotential Insight
    Drug DevelopmentComparative screening against both speciesIdentification of highly conserved drug targets
    Safety AssessmentCross-species toxicity profilingPrediction of species-specific adverse effects
    Model ValidationCorrelation of in vitro with in vivo findingsTranslation validity between bovine and human models

This comparative approach not only advances our understanding of CHRNA5 biology across species but also strengthens the translational value of bovine models in neuropharmacological research.

What are the methodological challenges in correlating in vitro findings with CHRNA5 with in vivo functional outcomes?

Translating in vitro findings about CHRNA5 to in vivo functional outcomes presents several methodological challenges that researchers must address:

  • Complexity of Receptor Assembly and Trafficking:

    • In vitro systems often fail to recapitulate the complex subunit assembly processes that occur in vivo.

    • Studies in Xenopus oocytes, cell lines, and neurons derived from human iPSCs have yielded conflicting results regarding CHRNA5 function , highlighting the importance of cellular context.

  • Physiological Expression Level Discrepancies:

    • Recombinant systems typically overexpress CHRNA5, potentially altering stoichiometry with other subunits.

    • Different promoter haplotypes significantly affect expression levels (up to 2-fold difference between variants) , which may not be accounted for in standard expression systems.

  • Methodological Approaches to Bridge the Gap:

    ApproachStrengthLimitation
    Humanized/Bovinized Animal ModelsPhysiological contextResource intensive
    Patient-Derived iPSCsMaintains genetic backgroundLimited to accessible cell types
    Tissue-Specific Conditional KnockoutsSpatial and temporal controlComplex phenotyping required
    Ex Vivo Tissue PreparationsPreserves tissue architectureShort experimental window
  • Integration Strategies:

    • Multi-level analysis connecting molecular interactions (e.g., CHRNA5-CES1) to cellular signaling (MAPK pathway) to tissue/organ function.

    • Careful phenotyping using translatable biomarkers that can be measured both in vitro and in vivo.

    • Development of mathematical models that predict in vivo outcomes based on in vitro parameters.

  • Data Interpretation Considerations:

    • Species differences in receptor distribution and density

    • Developmental regulation of receptor expression

    • Context-dependent protein-protein interactions

By systematically addressing these challenges, researchers can develop more robust frameworks for translating findings about bovine CHRNA5 from controlled in vitro systems to complex in vivo contexts, ultimately enhancing the predictive value of basic research.

How can single-cell techniques advance our understanding of cell-specific CHRNA5 expression and function?

Single-cell technologies offer unprecedented opportunities to dissect cell-specific CHRNA5 expression patterns and functional heterogeneity:

  • Single-Cell Transcriptomics Applications:

    • scRNA-seq to map CHRNA5 expression across different cell populations within complex tissues such as brain or lung.

    • Identification of novel cell populations with distinctive CHRNA5 expression patterns that may be masked in bulk tissue analysis.

    • Trajectory analysis to track developmental regulation of CHRNA5 expression during cell differentiation and maturation.

  • Spatial Transcriptomics Integration:

    • Combining scRNA-seq with spatial transcriptomics technologies (e.g., Visium, MERFISH) to map CHRNA5 expression within anatomical contexts.

    • Correlation of spatial expression patterns with local circuit functions in neural tissues.

    • Identification of microenvironmental factors influencing CHRNA5 expression.

  • Functional Single-Cell Analysis:

    TechniqueApplication to CHRNA5 ResearchKey Insight Potential
    Patch-seqLinking electrophysiological properties with CHRNA5 expressionCell-specific functional correlates
    CyTOFProtein-level quantification across thousands of cellsPost-transcriptional regulation patterns
    CRISPR-scRNA-seqPerturbation effects on cell-specific gene programsCHRNA5 regulatory networks
  • Methodological Considerations:

    • Protocol optimization for membrane protein detection at single-cell level

    • Computational approaches for integrating multi-modal single-cell data

    • Development of CHRNA5-specific probes for spatial transcriptomics

This multi-faceted single-cell approach can reveal previously unappreciated heterogeneity in CHRNA5 expression and function across cell types, potentially explaining conflicting results observed in prior studies using bulk tissue or homogeneous cell populations .

What emerging technologies show promise for studying the real-time dynamics of CHRNA5-containing receptors?

Several cutting-edge technologies are revolutionizing our ability to study real-time dynamics of CHRNA5-containing receptors:

  • Advanced Imaging Technologies:

    • Single-Molecule FRET: Enables real-time visualization of conformational changes in CHRNA5 upon ligand binding and during channel gating.

    • Super-Resolution Microscopy (STORM, PALM): Allows visualization of CHRNA5 clustering and movement within the membrane at nanometer resolution.

    • Lattice Light-Sheet Microscopy: Provides high-speed 3D imaging with minimal phototoxicity for long-term tracking of receptor dynamics.

  • Optogenetic and Chemogenetic Approaches:

    • Development of light-activated nicotinic receptor ligands for precise temporal control of receptor activation.

    • CHRNA5-specific DREADD (Designer Receptors Exclusively Activated by Designer Drugs) systems for cell-type specific modulation.

    • Optogenetic control of CHRNA5 expression through light-inducible promoter systems.

  • Biosensor Development:

    Biosensor TypeApplicationTechnical Advantage
    FRET-based Conformational SensorsReal-time monitoring of receptor state changesNon-invasive continuous measurement
    Genetically-Encoded Calcium IndicatorsDownstream signaling dynamicsCell-specific expression
    Voltage-Sensitive Fluorescent ProteinsChannel activity correlationDirect functional readout
  • Molecular Recording Technologies:

    • CRISPR-based molecular recorders that create a genomic "memory" of CHRNA5 activation events.

    • RNA timestamp technologies to track the temporal dynamics of CHRNA5-dependent transcriptional responses.

  • Artificial Intelligence Integration:

    • Deep learning approaches for automated analysis of complex receptor dynamics from imaging data.

    • Predictive modeling of receptor behavior based on multi-parameter datasets.

These emerging technologies promise to overcome current limitations in studying CHRNA5 dynamics, particularly addressing conflicting results observed in different experimental systems . By providing unprecedented temporal resolution and molecular detail, these approaches will help resolve fundamental questions about how CHRNA5 differentially modulates nicotinic receptor function across cellular contexts and in response to different stimuli.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.